LOOPP results

LOOPP parallel driver v5.0 (06/13/08 15:45 EDT) with LOOPP v3.0 (compiled Jul 11 2008 17:20:20)
     [NEWSABLE]     [HSHFL]     [ENE]     [NEWALICHOICE]

This is HTML output, the other options are plain text, CASP AL and CASP TS formats.

If an error occured during execution it is logged in plain text version only,
there is no need to look for an error if this file ends with 'DONE' statement.

STARTING:Wed Aug 06 15:41:47 2008 EST

INPUT:
   sim_min =  40.0% minimum sequence identity (%)
   sim_max =  80.0% maximum sequence identity (%)
   len_dif =  20.0% maximum length difference (% of query sequence length) 
                    between query and homolog
   nmax    =  1     maximum number of homologous sequences (including query sequence)
   maxout  =  5     maximum number of outputted matches
   strict  =  0     all alignments will be accepted from LOOPP results
                    for homologs; they will be translated to query sequence 
                    alignments using BLAST results
   casp    =  5     maximum number of outputted matches in CASP format
   align   =  'g'   only corresponding global alignments will be reported
   maxdiff =  50.0% only alignments differing no more than  50.0% from the query
                    sequence will be reported, or when reject=0, corresponding local
                    alignments will be reported
   reject  =  1     alignments shorter more than  50.0% from the query sequence
                    will be rejected
   seccut  =  0.00  structures with sec. str. score below seccut will be rejected
    secdb  = 1      type of secondary structure description: 1 - DSSB, 0 - phi/psi map
   tasktb  = 11111111111111111111  type of initial calculations
   pdbcut  =  60.0% pdb sequence identity threshold (%)
  pdbstop  = 0      stop if PDB structure with similarity above pdbcut found
  domains  = 0      query sequence will be decomposed into putative domains if =1
   maxall  = 200      maximum number of models evaluated in the second stage       
   refstr  = 0      if equal to 1 rmsd distances between all hits and a reference structure
                   will be reported
   maxpdb  = 5      number of top PDB hits added to the second stage scoring 
   maxdyn  = 5      number of dynamic domain entries from database added to the second stage scoring 
 beautify  = 0      use pdb beautifier 
rmsdtables  = 1     compute rmsd tables between hits 

   local LOOPP/BLAST database will be used

   input file T0387
    --> 91 residues, sequence name: T0387
   Database: T:\CBSU\blastdb\20080108\nr


 -> 91 homolog sequences with sequence identity from  40.0% to  80.0% satisfying length constraints found
 -> 0 representatives will be used in search (nmax=1 including query sequence)
 Histogram of all homolog sequences found by BLAST (e-value cutoff 0.01, length constr.) by sequence identity:
  00%-10%    10%-20%    20%-30%    30%-40%    40%-50%    50%-60%    60%-70%    70%-80%    80%-90%    90%-100% 

       0          0          0        111         71         10          2          7          5          9   

5 dynamic database entries created: 1GQ4_A 1I92_A 1GQ5_A 2HE4_A 2OCS_A 




RESULTS

secondary structure prediction shows 16.48% helical, 34.07% extended and 49.45% loops/other

homologs/domains used:
  0 query sequence T0387
all homologs found

total number of entries processed: 205

Amino acid profile calculated versus nr database is here
  (Amino acid profile BLAST run output is here)
Results of BLAST versus pdbaa database using the nr profile are here
  (Results of BLAST versus pdbaa database with no profile are here)
Transitive BLAST output calculted with this profile is here

Phase 1 scoring data: input and output
Phase 2 scoring data: input and output


HITS:

table legend
no    name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                               (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1    2EEJ_A               not_found     69.69.69.23            GOOD   -20.467     0       1  97.80%  94.38%   OPTM     -311.191     -275.000        6.815        0.775        0.832        0.908        0.978     47.680     -60.0    29.820   484.500    -531.0    47.620   454.000    -553.0     3.370     8.010     -18.4     2.370     3.710     -25.5    19.790    76.220     -81.9    32.360    65.580     -89.4    20.050    60.790     -73.7    35.020    53.480     -79.7   -30.000    28.000     -69.0   -30.000    27.000     -73.0    22.340   370.000    -345.0    43.370   316.000    -366.0     7.700    44.000     -19.0     7.940    23.000     -49.0     5.000     -35.2   -36.524      -7.8     0.000 -9.3e+061     5.000     -35.2    -3.523     -47.7    0.73  0.78
2    1GQ4_A               b.36.1.1      100.83.83.29           GOOD   -20.958     0       1  96.70%  45.45%   OPTM     -390.960     -338.380        5.106        0.840        0.880        0.970        0.992     31.100     -43.0    11.610   252.500    -252.0    16.960   203.500    -261.0     5.140    15.980     -26.1     2.570     7.950     -32.5    11.750    55.000     -53.0    15.740    33.840     -55.0    14.940    52.820     -62.9    23.210    35.390     -64.2   -30.000    42.000     -74.0   -30.000    30.000     -75.0    19.190   305.500    -277.0    41.370   240.000    -287.0     5.770    33.000     -33.0     6.380    16.000     -50.0     5.000     -37.7     2.034     -47.0     0.000 -9.3e+061     5.000     -37.7    -1.854     -19.7    0.58  0.87
3    2OCS_A               not_found     69.69.69.23            GOOD   -20.991     0       1  92.31%  44.83%   OPTM     -381.887     -315.450        5.111        0.851        0.890        0.923        0.944     30.820     -42.8    13.680   270.000    -263.5    21.140   225.500    -271.5     5.050    12.090     -20.4     3.430     8.510     -29.6    14.770    45.320     -41.4    14.160    29.420     -44.9    15.720    49.090     -53.9    24.560    31.210     -56.9   -30.000    37.000     -69.0   -30.000    29.000     -71.0    18.670   301.500    -277.0    33.490   245.000    -285.0     7.290    46.000     -51.0     7.920    30.000     -65.0     5.000     -33.7    -8.351     -30.8     0.000 -9.3e+061     5.000     -33.7     5.000     -19.0    0.45  0.88
4    1I92_A               b.36.1.1      100.83.83.29            LOW   -21.026     0       1  97.80%  44.94%   OPTM     -409.875     -337.410        5.218        0.845        0.850        0.971        0.992     32.180     -43.8    12.380   272.000    -266.0    17.630   211.500    -270.0     5.550    14.590     -25.8     3.130     8.190     -29.3    13.530    53.290     -53.3    15.980    39.730     -53.9    15.700    52.910     -64.6    22.720    36.860     -64.6   -30.000    44.000     -77.0   -30.000    33.000     -77.0    18.910   314.000    -282.0    39.130   244.000    -288.0     6.470    42.000     -40.0     7.660    24.000     -57.0     5.000     -37.5     1.762     -47.3     0.000 -9.3e+061     5.000     -37.5    -1.854     -20.0    0.73  0.88
5    1G9O_A               b.36.1.1      100.83.83.29            LOW   -21.041     0       1  97.80%  44.94%   OPTM     -321.920     -272.620        5.070        0.812        0.813        0.963        0.985     32.140     -46.4    12.540   264.500    -254.0    17.270   198.000    -257.0     4.090    16.400     -26.0     2.590     7.120     -27.3    11.030    59.430     -53.9    19.430    37.930     -54.5    14.390    60.980     -66.9    26.010    41.820     -66.9   -30.000    48.000     -81.0   -30.000    34.000     -81.0    17.200   285.000    -254.0    33.090   216.000    -258.0     8.270    47.000     -40.0     9.890    29.000     -56.0     5.000     -39.2     1.994     -47.3    36.000     120.0     5.000     -39.2    -1.854     -19.7    0.75  0.95



RMSD table between hits
(RMSDs are shaded according to similarity, up to 10Å )

	1	2	3	4	5
1	0.00	3.06	1.74	3.24	2.23
2	3.06	0.00	3.18	0.96	2.57
3	1.74	3.18	0.00	3.19	1.94
4	3.24	0.96	3.19	0.00	2.89
5	2.23	2.57	1.94	2.89	0.00



Similarity table for hits: percentage of chain fitting below 3Å RMSD
(Cells are shaded according to similarity starting at 30%)

	1	2	3	4	5
1	100.00	98.86	100.00	98.88	100.00
2	98.86	100.00	98.85	100.00	100.00
3	100.00	98.85	100.00	98.85	100.00
4	98.88	100.00	98.85	100.00	100.00
5	100.00	100.00	100.00	100.00	100.00



Similarity table for hits: percentage of chain fitting below 6Å RMSD
(Cells are shaded according to similarity starting at 50%)

	1	2	3	4	5
1	100.00	100.00	100.00	100.00	100.00
2	100.00	100.00	100.00	100.00	100.00
3	100.00	100.00	100.00	100.00	100.00
4	100.00	100.00	100.00	100.00	100.00
5	100.00	100.00	100.00	100.00	100.00





ALIGNMENTS

--> hit 1 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 17.02% helical, 23.40% extended, 59.57% loops/other (query: 16.48% 34.07% 49.45%)

  SCOP classification: 


 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
2EEJ_A               not_found     69.69.69.23            GOOD   -20.467     0       1  97.80%  94.38%   OPTM     -311.191     -275.000        6.815        0.775        0.832        0.908        0.978     47.680     -60.0    29.820   484.500    -531.0    47.620   454.000    -553.0     3.370     8.010     -18.4     2.370     3.710     -25.5    19.790    76.220     -81.9    32.360    65.580     -89.4    20.050    60.790     -73.7    35.020    53.480     -79.7   -30.000    28.000     -69.0   -30.000    27.000     -73.0    22.340   370.000    -345.0    43.370   316.000    -366.0     7.700    44.000     -19.0     7.940    23.000     -49.0     5.000     -35.2   -36.524      -7.8     0.000 -9.3e+061     5.000     -35.2    -3.523     -47.7    0.73  0.78

alignment source: OPTM
            -----EEEEE-----EEEEEEE------EEEEEE-----HHH-------EEEEE---EE----HHHHHHHHHH----EEE
Query:    1 SMKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTL   80
Sbjct:    5 SSGPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTL   84
            ---EEEEEE--------EE--------EEEE------HHHHH------EE-EE---------HHHHHHHHHHH--EEEEE

            EEE------
Query:   81 LVCGKKAQD   89
Sbjct:   85 LVCGKKSGP   93
            E--------

89 residues (97.80%) of query sequence aligned



--> hit 2 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 14.61% helical, 29.21% extended, 56.18% loops/other (query: 16.48% 34.07% 49.45%)

  SCOP classification:  [All beta proteins]/[PDZ domain-like]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1GQ4_A               b.36.1.1      100.83.83.29           GOOD   -20.958     0       1  96.70%  45.45%   OPTM     -390.960     -338.380        5.106        0.840        0.880        0.970        0.992     31.100     -43.0    11.610   252.500    -252.0    16.960   203.500    -261.0     5.140    15.980     -26.1     2.570     7.950     -32.5    11.750    55.000     -53.0    15.740    33.840     -55.0    14.940    52.820     -62.9    23.210    35.390     -64.2   -30.000    42.000     -74.0   -30.000    30.000     -75.0    19.190   305.500    -277.0    41.370   240.000    -287.0     5.770    33.000     -33.0     6.380    16.000     -50.0     5.000     -37.7     2.034     -47.0     0.000 -9.3e+061     5.000     -37.7    -1.854     -19.7    0.58  0.87

alignment source: OPTM
            ----EEEEE-----EEEEEEE------EEEEEE-----HHH-------EEEEE---EE----HHHHHHHHHH----EEEE
Query:    2 MKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLL   81
Sbjct:   10 MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLL   89
            ---EEEEEE--------EEE--------EEE------HHHH-------EEEEE--EE-----HHHHHHHHH----EEEEE

            EE------
Query:   82 VCGKKAQD   89
Sbjct:   90 VVDPENDS   97
            EE------

88 residues (96.70%) of query sequence aligned



--> hit 3 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 15.48% helical, 39.29% extended, 45.24% loops/other (query: 16.48% 34.07% 49.45%)

  SCOP classification: 


 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
2OCS_A               not_found     69.69.69.23            GOOD   -20.991     0       1  92.31%  44.83%   OPTM     -381.887     -315.450        5.111        0.851        0.890        0.923        0.944     30.820     -42.8    13.680   270.000    -263.5    21.140   225.500    -271.5     5.050    12.090     -20.4     3.430     8.510     -29.6    14.770    45.320     -41.4    14.160    29.420     -44.9    15.720    49.090     -53.9    24.560    31.210     -56.9   -30.000    37.000     -69.0   -30.000    29.000     -71.0    18.670   301.500    -277.0    33.490   245.000    -285.0     7.290    46.000     -51.0     7.920    30.000     -65.0     5.000     -33.7    -8.351     -30.8     0.000 -9.3e+061     5.000     -33.7     5.000     -19.0    0.45  0.88

alignment source: OPTM
 +++ there is a problem with all-atom model, click here for details
            ---EEEEE-----EEEEEEE------EEEEEE-----HHH-------EEEEE---EE----HHHHHHHHHH----EEEEE
Query:    3 KPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLV   82
Sbjct:    7 MPRLCRLVRGEQGYGFHLHGER---GQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLV   83
            --EEEEEE-------EEEEE--   -EEEEEE----HHHH------EEEEEE--EE-----HHHHHHHHH----EEEEEE

            E------
Query:   83 CGKKAQD   89
Sbjct:   84 VDQEDTS   90
            EE-----

84 residues (92.31%) of query sequence aligned



--> hit 4 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 15.56% helical, 28.89% extended, 55.56% loops/other (query: 16.48% 34.07% 49.45%)

  SCOP classification:  [All beta proteins]/[PDZ domain-like]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1I92_A               b.36.1.1      100.83.83.29            LOW   -21.026     0       1  97.80%  44.94%   OPTM     -409.875     -337.410        5.218        0.845        0.850        0.971        0.992     32.180     -43.8    12.380   272.000    -266.0    17.630   211.500    -270.0     5.550    14.590     -25.8     3.130     8.190     -29.3    13.530    53.290     -53.3    15.980    39.730     -53.9    15.700    52.910     -64.6    22.720    36.860     -64.6   -30.000    44.000     -77.0   -30.000    33.000     -77.0    18.910   314.000    -282.0    39.130   244.000    -288.0     6.470    42.000     -40.0     7.660    24.000     -57.0     5.000     -37.5     1.762     -47.3     0.000 -9.3e+061     5.000     -37.5    -1.854     -20.0    0.73  0.88

alignment source: OPTM
            -----EEEEE-----EEEEEEE------EEEEEE-----HHH-------EEEEE---EE----HHHHHHHHHH----EEE
Query:    1 SMKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTL   80
Sbjct:    9 GMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRL   88
            ----EEEEEE--------EEE--------EEE------HHHH-------EEEEE--EE-----HHHHHHHHHH---EEEE

            EEE------
Query:   81 LVCGKKAQD   89
Sbjct:   89 LVVDPEQDT   97
            EEE------

89 residues (97.80%) of query sequence aligned



--> hit 5 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 14.44% helical, 34.44% extended, 51.11% loops/other (query: 16.48% 34.07% 49.45%)

  SCOP classification:  [All beta proteins]/[PDZ domain-like]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1G9O_A               b.36.1.1      100.83.83.29            LOW   -21.041     0       1  97.80%  44.94%   OPTM     -321.920     -272.620        5.070        0.812        0.813        0.963        0.985     32.140     -46.4    12.540   264.500    -254.0    17.270   198.000    -257.0     4.090    16.400     -26.0     2.590     7.120     -27.3    11.030    59.430     -53.9    19.430    37.930     -54.5    14.390    60.980     -66.9    26.010    41.820     -66.9   -30.000    48.000     -81.0   -30.000    34.000     -81.0    17.200   285.000    -254.0    33.090   216.000    -258.0     8.270    47.000     -40.0     9.890    29.000     -56.0     5.000     -39.2     1.994     -47.3    36.000     120.0     5.000     -39.2    -1.854     -19.7    0.75  0.95

alignment source: OPTM
            -----EEEEE-----EEEEEEE------EEEEEE-----HHH-------EEEEE---EE----HHHHHHHHHH----EEE
Query:    1 SMKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTL   80
Sbjct:    9 RMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRL   88
            ----EEEEEE-------EEEEE------EEEEEE----HHHH-------EEEEE--EE-----HHHHHHHHH----EEEE

            EEE------
Query:   81 LVCGKKAQD   89
Sbjct:   89 LVVDPETDE   97
            EEE------

89 residues (97.80%) of query sequence aligned




DONE: Wed Aug 06 18:04:40 2008 EST

00%-10%	10%-20%	20%-30%	30%-40%	40%-50%	50%-60%	60%-70%	70%-80%	80%-90%	90%-100%
0	0	0	111	71	10	2	7	5	9