LOOPP results

LOOPP parallel driver v5.0 (06/13/08 15:45 EDT) with LOOPP v3.0 (compiled Jul 11 2008 17:20:20)
     [NEWSABLE]     [HSHFL]     [ENE]     [NEWALICHOICE]

This is HTML output, the other options are plain text, CASP AL and CASP TS formats.

If an error occured during execution it is logged in plain text version only,
there is no need to look for an error if this file ends with 'DONE' statement.

STARTING:Thu Aug 07 01:33:58 2008 EST

INPUT:
   sim_min =  40.0% minimum sequence identity (%)
   sim_max =  80.0% maximum sequence identity (%)
   len_dif =  20.0% maximum length difference (% of query sequence length) 
                    between query and homolog
   nmax    =  1     maximum number of homologous sequences (including query sequence)
   maxout  =  5     maximum number of outputted matches
   strict  =  0     all alignments will be accepted from LOOPP results
                    for homologs; they will be translated to query sequence 
                    alignments using BLAST results
   casp    =  5     maximum number of outputted matches in CASP format
   align   =  'g'   only corresponding global alignments will be reported
   maxdiff =  50.0% only alignments differing no more than  50.0% from the query
                    sequence will be reported, or when reject=0, corresponding local
                    alignments will be reported
   reject  =  1     alignments shorter more than  50.0% from the query sequence
                    will be rejected
   seccut  =  0.00  structures with sec. str. score below seccut will be rejected
    secdb  = 1      type of secondary structure description: 1 - DSSB, 0 - phi/psi map
   tasktb  = 11111111111111111111  type of initial calculations
   pdbcut  =  60.0% pdb sequence identity threshold (%)
  pdbstop  = 0      stop if PDB structure with similarity above pdbcut found
  domains  = 0      query sequence will be decomposed into putative domains if =1
   maxall  = 200      maximum number of models evaluated in the second stage       
   refstr  = 0      if equal to 1 rmsd distances between all hits and a reference structure
                   will be reported
   maxpdb  = 5      number of top PDB hits added to the second stage scoring 
   maxdyn  = 5      number of dynamic domain entries from database added to the second stage scoring 
 beautify  = 0      use pdb beautifier 
rmsdtables  = 1     compute rmsd tables between hits 

   local LOOPP/BLAST database will be used

   input file T0390
    --> 182 residues, sequence name: T0390
   Database: T:\CBSU\blastdb\20080108\nr


 -> 18 homolog sequences with sequence identity from  40.0% to  80.0% satisfying length constraints found
 -> 0 representatives will be used in search (nmax=1 including query sequence)
 Histogram of all homolog sequences found by BLAST (e-value cutoff 0.01, length constr.) by sequence identity:
  00%-10%    10%-20%    20%-30%    30%-40%    40%-50%    50%-60%    60%-70%    70%-80%    80%-90%    90%-100% 

       0          0         11          0          5          3          7          3         10          8   

5 dynamic database entries created: 2I85_A 1KGY_E 2HLE_B 1V5S_A 2DBI_A 




RESULTS

secondary structure prediction shows 12.64% helical, 27.47% extended and 59.89% loops/other

homologs/domains used:
  0 query sequence T0390
all homologs found

total number of entries processed: 205

Amino acid profile calculated versus nr database is here
  (Amino acid profile BLAST run output is here)
Results of BLAST versus pdbaa database using the nr profile are here
  (Results of BLAST versus pdbaa database with no profile are here)
Transitive BLAST output calculted with this profile is here

Phase 1 scoring data: input and output
Phase 2 scoring data: input and output


HITS:

table legend
no    name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                               (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1    b.6.1.5.2_A          b.6.1.5       123.6.6.6              NONE   -46.025     0       1  75.27%  51.09%   OPTM     -567.779     -378.410        7.778        0.574        0.604        0.981        0.988     41.040     -63.8    19.750   395.500    -366.5    32.270   435.500    -514.0    -0.130    -0.460      14.1     5.400     9.050     -40.9     8.810    40.590      -3.0    31.130    79.250     -97.4     9.890    16.990     -21.8    29.880    50.600     -94.9   -30.000    11.000     -75.0   -30.000    16.000    -102.0    31.050   570.000    -499.0    63.740   580.000    -630.0     1.400    28.000      32.0    10.930    39.000     -85.0     5.000     -59.5    -9.251     -23.3     0.000 -9.3e+061     5.000     -59.5    -0.444     -40.7    0.24  0.74
2    1SHW_A               b.6.1.5       123.6.6.6              NONE   -46.096     0       1  75.27%  51.82%   OPTM     -623.677     -281.850        7.578        0.542        0.636        0.979        0.986     42.220     -63.6    19.220   393.500    -360.0    32.870   437.500    -515.0    -1.060    -3.850      21.9     3.140     6.410     -41.8     4.540    21.510      22.6    27.630    72.780     -96.3     7.230    13.320     -10.0    26.550    48.250     -92.8   -30.000    10.000     -73.0   -30.000    17.000    -102.0    30.160   573.000    -494.0    66.050   584.000    -631.0     0.610    21.000      30.0     9.590    34.000     -85.0     5.000     -59.5    -9.251     -23.3     0.000 -9.3e+061     5.000     -59.5    -0.444     -40.7    0.24  0.77
3    1KGY_E               b.6.1.5       123.6.6.6              NONE   -47.590     0       1  71.98%  27.48%   OPTM     -418.050     -222.320        4.620        0.479        0.490        0.743        0.779     22.920     -44.8     7.450   135.000    -101.0    18.550   158.500    -248.0     0.920     0.920      13.4     2.370    -2.890     -35.7     5.830    25.210      16.3    14.300    28.310     -50.2     5.440    11.410     -12.7     5.320     9.610     -56.9   -30.000     0.000     -65.0   -30.000     0.000     -80.0    21.360   421.000    -331.0    55.810   417.000    -454.0    -2.250    -3.000      49.0     3.920     7.000     -61.0     5.000     -48.7    -4.261     -30.4     0.000 -9.3e+061     5.000     -48.7    -1.602     -14.7    0.58  0.20
4    1IKO_P               b.6.1.5       123.6.6.6              NONE   -47.663     0       1  71.43%  27.69%   OPTM     -382.947     -167.120        4.651        0.466        0.348        0.724        0.777     24.370     -44.5     7.450   147.000    -116.5    17.830   160.000    -250.5     0.040    -0.150      15.5     1.900    -1.120     -33.5     3.410    14.460      22.7    11.000    22.080     -42.2     5.170    10.780     -10.8     9.470    17.150     -61.9   -30.000    -5.000     -70.0   -30.000     8.000     -94.0    21.450   412.000    -333.0    52.590   423.000    -469.0    -2.030     9.000      46.0     3.800     3.000     -60.0     5.000     -49.3    -4.789     -29.6   -26.000     177.0     5.000     -48.7    -1.495     -15.0    0.36  0.87
5    b.6.1.5.1_B          b.6.1.5       123.6.6.6              NONE   -47.841     0       1  71.98%  27.48%   OPTM     -346.242     -179.280        4.118        0.468        0.506        0.715        0.724     22.240     -41.6     7.640   122.500     -82.0    16.580   138.500    -234.0     1.160     4.860      20.0     1.300    -0.400     -33.1     1.220     6.180      44.0     8.200    16.790     -40.1     2.670     2.420       8.6    10.090    17.740     -59.4   -30.000     0.000     -63.0   -30.000     3.000     -90.0    21.640   409.000    -304.0    48.720   382.000    -425.0    -3.060    -6.000      58.0     1.420    -4.000     -55.0     5.000     -46.1    -1.499     -49.7     0.000 -9.3e+061     5.000     -46.1    -0.585     -13.2    0.38  0.78



RMSD table between hits
(RMSDs are shaded according to similarity, up to 10Å )

	1	2	3	4	5
1	0.00	0.90	5.20	6.42	5.61
2	0.90	0.00	5.21	6.45	5.61
3	5.20	5.21	0.00	4.01	3.54
4	6.42	6.45	4.01	0.00	3.18
5	5.61	5.61	3.54	3.18	0.00



Similarity table for hits: percentage of chain fitting below 3Å RMSD
(Cells are shaded according to similarity starting at 30%)

	1	2	3	4	5
1	100.00	100.00	61.83	29.23	31.30
2	100.00	100.00	61.83	29.23	32.06
3	61.83	61.83	100.00	66.15	67.18
4	29.23	29.23	66.15	100.00	51.54
5	31.30	32.06	67.18	51.54	100.00



Similarity table for hits: percentage of chain fitting below 6Å RMSD
(Cells are shaded according to similarity starting at 50%)

	1	2	3	4	5
1	100.00	100.00	100.00	66.15	100.00
2	100.00	100.00	100.00	66.15	100.00
3	100.00	100.00	100.00	100.00	100.00
4	66.15	66.15	100.00	100.00	100.00
5	100.00	100.00	100.00	100.00	100.00





ALIGNMENTS

--> hit 1 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure:  6.57% helical, 34.31% extended, 59.12% loops/other (query: 12.64% 27.47% 59.89%)

  SCOP classification:  [All beta proteins]/[Cupredoxin-like]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
b.6.1.5.2_A          b.6.1.5       123.6.6.6              NONE   -46.025     0       1  75.27%  51.09%   OPTM     -567.779     -378.410        7.778        0.574        0.604        0.981        0.988     41.040     -63.8    19.750   395.500    -366.5    32.270   435.500    -514.0    -0.130    -0.460      14.1     5.400     9.050     -40.9     8.810    40.590      -3.0    31.130    79.250     -97.4     9.890    16.990     -21.8    29.880    50.600     -94.9   -30.000    11.000     -75.0   -30.000    16.000    -102.0    31.050   570.000    -499.0    63.740   580.000    -630.0     1.400    28.000      32.0    10.930    39.000     -85.0     5.000     -59.5    -9.251     -23.3     0.000 -9.3e+061     5.000     -59.5    -0.444     -40.7    0.24  0.74

alignment source: OPTM
            ----EEEE-----------EEEEEE---EEEEEEE-------------EEEEEEE-HHHHH---------EEEEE-----
Query:   29 ADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSA  108
Sbjct:   33 ADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYED-SVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHS  111
            -EEEEE-----HHHH----EEEE----EEEEE------- --------EEEEEE-HHHHH-------EEEEEEE------

            -----HHHHHHHE--------EEE---EEEEEE------ ---EEEEEEEEEEE----
Query:  109 KHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQH-EDRCLRLKVTVSGKITHS  165
Sbjct:  112 PNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCM  169
            ----EEEEE----------------EEEEEEEEE----------EEEEEE-------M

137 residues (75.27%) of query sequence aligned



--> hit 2 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure:  7.30% helical, 33.58% extended, 59.12% loops/other (query: 12.64% 27.47% 59.89%)

  SCOP classification:  [All beta proteins]/[Cupredoxin-like]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1SHW_A               b.6.1.5       123.6.6.6              NONE   -46.096     0       1  75.27%  51.82%   OPTM     -623.677     -281.850        7.578        0.542        0.636        0.979        0.986     42.220     -63.6    19.220   393.500    -360.0    32.870   437.500    -515.0    -1.060    -3.850      21.9     3.140     6.410     -41.8     4.540    21.510      22.6    27.630    72.780     -96.3     7.230    13.320     -10.0    26.550    48.250     -92.8   -30.000    10.000     -73.0   -30.000    17.000    -102.0    30.160   573.000    -494.0    66.050   584.000    -631.0     0.610    21.000      30.0     9.590    34.000     -85.0     5.000     -59.5    -9.251     -23.3     0.000 -9.3e+061     5.000     -59.5    -0.444     -40.7    0.24  0.77

alignment source: OPTM
            ----EEEE-----------EEEEEE---EEEEEEE-------------EEEEEEE-HHHHH---------EEEEE-----
Query:   29 ADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSA  108
Sbjct:   33 ADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYED-SVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHS  111
            -EEEEE-----HHHH----EEEE----EEEEE------- --------EEEEEE-HHHHHH------EEEEEEE------

            -----HHHHHHHE--------EEE---EEEEEE--------- EEEEEEEEEEE----
Query:  109 KHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDR-CLRLKVTVSGKITHS  165
Sbjct:  112 PNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCM  169
            ----EEEEE-----------------EEEEEEEE----------EEEEEE-------M

137 residues (75.27%) of query sequence aligned



--> hit 3 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure:  0.00% helical,  0.00% extended, 100.00% loops/other (query: 12.64% 27.47% 59.89%)

  SCOP classification:  [All beta proteins]/[Cupredoxin-like]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1KGY_E               b.6.1.5       123.6.6.6              NONE   -47.590     0       1  71.98%  27.48%   OPTM     -418.050     -222.320        4.620        0.479        0.490        0.743        0.779     22.920     -44.8     7.450   135.000    -101.0    18.550   158.500    -248.0     0.920     0.920      13.4     2.370    -2.890     -35.7     5.830    25.210      16.3    14.300    28.310     -50.2     5.440    11.410     -12.7     5.320     9.610     -56.9   -30.000     0.000     -65.0   -30.000     0.000     -80.0    21.360   421.000    -331.0    55.810   417.000    -454.0    -2.250    -3.000      49.0     3.920     7.000     -61.0     5.000     -48.7    -4.261     -30.4     0.000 -9.3e+061     5.000     -48.7    -1.602     -14.7    0.58  0.20

alignment source: OPTM
            ----EEEE-------- ---EEEEEE---EEEEEEE-------------EEEEEEE-HHHHH---------EEEEE----
Query:   29 ADRHTVFWNSSNPKFR-NEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPS  107
Sbjct: 1031 IVLEPIYWNSSNSKFLPGGGLVLYPQIGDKLDIICPKVDSKTVGQ--YEYYKVYMVDKDQADRCTIKKENTPLLNCARPD 1108
            ---------------------------------------------  ---------------------------------

            ----     --HHHHHHHE--------EEE---EEEEEE-------           --EEEEEEEEE
Query:  108 AKHG-----PEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHE-----------DRCLRLKVTVS  159
Sbjct: 1109 QDVKFTIKFQE--------FSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG 1168
            -----------        -------------------------------------------------

131 residues (71.98%) of query sequence aligned



--> hit 4 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure:  7.91% helical, 25.90% extended, 66.19% loops/other (query: 12.64% 27.47% 59.89%)

  SCOP classification:  [All beta proteins]/[Cupredoxin-like]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1IKO_P               b.6.1.5       123.6.6.6              NONE   -47.663     0       1  71.43%  27.69%   OPTM     -382.947     -167.120        4.651        0.466        0.348        0.724        0.777     24.370     -44.5     7.450   147.000    -116.5    17.830   160.000    -250.5     0.040    -0.150      15.5     1.900    -1.120     -33.5     3.410    14.460      22.7    11.000    22.080     -42.2     5.170    10.780     -10.8     9.470    17.150     -61.9   -30.000    -5.000     -70.0   -30.000     8.000     -94.0    21.450   412.000    -333.0    52.590   423.000    -469.0    -2.030     9.000      46.0     3.800     3.000     -60.0     5.000     -49.3    -4.789     -29.6   -26.000     177.0     5.000     -48.7    -1.495     -15.0    0.36  0.87

alignment source: OPTM
            ----EEEE-------- ---EEEEEE---EEEEEEE-------------EEEEEEE-HHHHH---------EEEEE----
Query:   29 ADRHTVFWNSSNPKFR-NEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPS  107
Sbjct:   31 IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQY--EYYKVYMVDKDQADRCTIKKENTPLLNCARPD  108
            ----EE-------------EEE------EEEEE-------------  -EEEEEE-HHHHHH----------EEE-----

            --     ----HHHHHHHE--------EEE---EEEEEE--------           -EEEEEEEE
Query:  108 AK-----HGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHED-----------RCLRLKVTV  158
Sbjct:  109 QDVKFTIKFQE--------FSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKV  167
            --EEEEE----        ------------EEEEEE---------------HHHHH---EEEEEE-

130 residues (71.43%) of query sequence aligned



--> hit 5 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure:  3.03% helical, 28.79% extended, 68.18% loops/other (query: 12.64% 27.47% 59.89%)

  SCOP classification:  [All beta proteins]/[Cupredoxin-like]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
b.6.1.5.1_B          b.6.1.5       123.6.6.6              NONE   -47.841     0       1  71.98%  27.48%   OPTM     -346.242     -179.280        4.118        0.468        0.506        0.715        0.724     22.240     -41.6     7.640   122.500     -82.0    16.580   138.500    -234.0     1.160     4.860      20.0     1.300    -0.400     -33.1     1.220     6.180      44.0     8.200    16.790     -40.1     2.670     2.420       8.6    10.090    17.740     -59.4   -30.000     0.000     -63.0   -30.000     3.000     -90.0    21.640   409.000    -304.0    48.720   382.000    -425.0    -3.060    -6.000      58.0     1.420    -4.000     -55.0     5.000     -46.1    -1.499     -49.7     0.000 -9.3e+061     5.000     -46.1    -0.585     -13.2    0.38  0.78

alignment source: OPTM
            ----EEEE-------- ---EEEEEE---EEEEEEE-------------EEEEEEE-HHHHH---------EEEEE----
Query:   29 ADRHTVFWNSSNPKFR-NEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPS  107
Sbjct:   31 IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVQ---YEYYKVYMVDKDQADRCTIKPL----LNCARPD  103
            -----EE-------------EEE------EEEEEE---------   ---EEEEEE-HHHH--------    EEE----

            ----     --HHHHHHHE--------EEE---EEEEEE-------           --EEEEEEEEE
Query:  108 AKHG-----PEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHE-----------DRCLRLKVTVS  159
Sbjct:  104 QDVKFTIKFQE--------FSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG  163
            --EEEEEE---        -------------EEEEEE-----------------------EEEEEE-

131 residues (71.98%) of query sequence aligned




DONE: Thu Aug 07 06:29:15 2008 EST

00%-10%	10%-20%	20%-30%	30%-40%	40%-50%	50%-60%	60%-70%	70%-80%	80%-90%	90%-100%
0	0	11	0	5	3	7	3	10	8