LOOPP results

LOOPP parallel driver v5.0 (06/13/08 15:45 EDT) with LOOPP v3.0 (compiled Jul 11 2008 17:20:20)
     [NEWSABLE]     [HSHFL]     [ENE]     [NEWALICHOICE]

This is HTML output, the other options are plain text, CASP AL and CASP TS formats.

If an error occured during execution it is logged in plain text version only,
there is no need to look for an error if this file ends with 'DONE' statement.

STARTING:Thu Aug 07 10:10:25 2008 EST

INPUT:
   sim_min =  40.0% minimum sequence identity (%)
   sim_max =  80.0% maximum sequence identity (%)
   len_dif =  20.0% maximum length difference (% of query sequence length) 
                    between query and homolog
   nmax    =  1     maximum number of homologous sequences (including query sequence)
   maxout  =  5     maximum number of outputted matches
   strict  =  0     all alignments will be accepted from LOOPP results
                    for homologs; they will be translated to query sequence 
                    alignments using BLAST results
   casp    =  5     maximum number of outputted matches in CASP format
   align   =  'g'   only corresponding global alignments will be reported
   maxdiff =  50.0% only alignments differing no more than  50.0% from the query
                    sequence will be reported, or when reject=0, corresponding local
                    alignments will be reported
   reject  =  1     alignments shorter more than  50.0% from the query sequence
                    will be rejected
   seccut  =  0.00  structures with sec. str. score below seccut will be rejected
    secdb  = 1      type of secondary structure description: 1 - DSSB, 0 - phi/psi map
   tasktb  = 11111111111111111111  type of initial calculations
   pdbcut  =  60.0% pdb sequence identity threshold (%)
  pdbstop  = 0      stop if PDB structure with similarity above pdbcut found
  domains  = 0      query sequence will be decomposed into putative domains if =1
   maxall  = 200      maximum number of models evaluated in the second stage       
   refstr  = 0      if equal to 1 rmsd distances between all hits and a reference structure
                   will be reported
   maxpdb  = 5      number of top PDB hits added to the second stage scoring 
   maxdyn  = 5      number of dynamic domain entries from database added to the second stage scoring 
 beautify  = 0      use pdb beautifier 
rmsdtables  = 1     compute rmsd tables between hits 

   local LOOPP/BLAST database will be used

   input file T0392
    --> 109 residues, sequence name: T0392
   Database: T:\CBSU\blastdb\20080108\nr


 -> 6 homolog sequences with sequence identity from  40.0% to  80.0% satisfying length constraints found
 -> 0 representatives will be used in search (nmax=1 including query sequence)
 Histogram of all homolog sequences found by BLAST (e-value cutoff 0.01, length constr.) by sequence identity:
  00%-10%    10%-20%    20%-30%    30%-40%    40%-50%    50%-60%    60%-70%    70%-80%    80%-90%    90%-100% 

       0          0          0          2          6          0          0          0          0          0   

5 dynamic database entries created: 2BYG_A 2IWQ_A 2R4H_A 2AW5_A 2DLS_A 




RESULTS

secondary structure prediction shows 11.93% helical, 26.61% extended and 61.47% loops/other

homologs/domains used:
  0 query sequence T0392
all homologs found

total number of entries processed: 205

Amino acid profile calculated versus nr database is here
  (Amino acid profile BLAST run output is here)
Results of BLAST versus pdbaa database using the nr profile are here
  (Results of BLAST versus pdbaa database with no profile are here)
Transitive BLAST output calculted with this profile is here

Phase 1 scoring data: input and output
Phase 2 scoring data: input and output


HITS:

table legend
no    name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                               (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1    2OCS_A               not_found     72.72.72.26           GUESS   -26.063     0       1  77.98%  27.91%   OPTM     -355.099     -211.870        3.267        0.725        0.847        0.969        0.980     22.470     -35.7     4.740    78.500     -63.0     7.350    83.000    -132.0     1.570     3.660       2.9     1.380    -0.770     -27.4     7.600    22.860      -2.2     6.540    13.630     -33.5    17.470    27.930     -26.5    19.730    28.770     -52.0   -30.000    21.000     -54.0   -30.000    34.000     -76.0     9.860   121.000    -102.0    22.180   132.000    -171.0     3.730    19.000      -6.0     6.090    26.000     -62.0     5.000     -18.3     1.427     -65.2     0.000 -9.3e+061     5.000     -17.0     0.763      -5.5    0.33  0.68
2    b.36.1.1.1_A         b.36.1.1      101.79.79.75          GUESS   -26.104     0       1  73.39%  23.75%   OPTM     -342.206     -203.850        2.690        0.844        0.780        0.943        0.990     21.780     -33.9     4.250    73.000     -50.0    10.010    96.000    -145.0     1.320     4.400       5.9     1.320     2.160     -28.1     3.110    14.950      14.2     7.850    18.560     -34.8     8.540    25.030     -13.3    18.940    25.800     -50.2   -30.000    21.000     -49.0   -30.000    31.000     -72.0     5.910    90.000     -38.0    15.800   102.000    -132.0     2.590    14.000       8.0     7.030    26.000     -52.0     5.000     -10.7    -2.639     -35.6   -36.000     126.0     5.000     -10.7     5.000       5.0    0.34  0.64
3    1VAE_A               b.36.1.1      101.79.79.75          GUESS   -26.122     0       1  92.66%  70.59%   OPTM     -371.921     -220.700        6.713        0.716        0.849        0.821        0.892     45.550     -59.0    22.920   443.500    -440.5    40.980   434.500    -491.5     1.520     1.780     -17.0     1.660    -0.980     -23.2    15.060    58.900     -59.5    33.560    56.690     -79.8    12.640    35.960     -60.1    23.110    47.470     -78.1   -30.000    16.000     -69.0   -30.000    26.000     -82.0    22.280   403.000    -360.0    51.460   368.000    -403.0     6.810    45.000       8.0    10.000    41.000     -75.0     5.000     -41.0   -16.393     -20.8   -27.000     160.0     5.000     -41.0     5.000     -40.5    0.34  0.86
4    b.36.1.1.5_A         b.36.1.1      101.79.79.75          GUESS   -26.216     0       1  74.31%  23.46%   OPTM     -341.224     -196.570        2.931        0.771        0.744        0.934        0.979     23.010     -35.0     5.540    86.000     -71.5    10.410    99.500    -149.0     2.220     7.680      -1.2     1.290     2.160     -28.3     6.670    27.510      -1.8     8.810    18.860     -36.1    12.390    27.890     -22.3    18.050    26.270     -51.2   -30.000    21.000     -51.0   -30.000    32.000     -73.0     6.900    91.000     -54.0    16.880   106.000    -134.0     3.840    20.000      -1.0     7.770    29.000     -57.0     5.000     -10.7    -2.581     -35.6     0.000 -9.3e+061     5.000     -10.7     5.000       5.0    0.33  0.65
5    b.36.1.1.14_A        b.36.1.1      101.79.79.75          GUESS   -26.222     0       1  70.64%  21.79%   OPTM     -342.261     -234.130        2.627        0.849        0.667        0.966        0.978     17.300     -29.1     1.860    35.000       4.5     4.400    37.000     -91.5     0.870    -1.880      12.9     1.570     2.850     -26.3     5.000    10.700      17.2     5.930    12.190     -29.7    12.360    23.640      -8.2    16.140    23.020     -45.9   -30.000    19.000     -39.0   -30.000    25.000     -67.0     7.830   119.000     -57.0    22.710   110.000    -148.0     1.100    12.000      23.0     4.640    23.000     -51.0     5.000     -13.5     3.130     -58.5     0.000 -9.3e+061     5.000     -13.5     0.940      -3.0    0.45  0.72



RMSD table between hits
(RMSDs are shaded according to similarity, up to 10Å )

	1	2	3	4	5
1	0.00	1.62	2.43	1.83	1.57
2	1.62	0.00	2.16	0.57	1.36
3	2.43	2.16	0.00	2.32	2.07
4	1.83	0.57	2.32	0.00	1.54
5	1.57	1.36	2.07	1.54	0.00



Similarity table for hits: percentage of chain fitting below 3Å RMSD
(Cells are shaded according to similarity starting at 30%)

	1	2	3	4	5
1	100.00	100.00	100.00	100.00	100.00
2	100.00	100.00	100.00	100.00	100.00
3	100.00	100.00	100.00	100.00	100.00
4	100.00	100.00	100.00	100.00	100.00
5	100.00	100.00	100.00	100.00	100.00



Similarity table for hits: percentage of chain fitting below 6Å RMSD
(Cells are shaded according to similarity starting at 50%)

	1	2	3	4	5
1	100.00	100.00	100.00	100.00	100.00
2	100.00	100.00	100.00	100.00	100.00
3	100.00	100.00	100.00	100.00	100.00
4	100.00	100.00	100.00	100.00	100.00
5	100.00	100.00	100.00	100.00	100.00





ALIGNMENTS

--> hit 1 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 15.48% helical, 39.29% extended, 45.24% loops/other (query: 11.93% 26.61% 61.47%)

  SCOP classification: 


 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
2OCS_A               not_found     72.72.72.26           GUESS   -26.063     0       1  77.98%  27.91%   OPTM     -355.099     -211.870        3.267        0.725        0.847        0.969        0.980     22.470     -35.7     4.740    78.500     -63.0     7.350    83.000    -132.0     1.570     3.660       2.9     1.380    -0.770     -27.4     7.600    22.860      -2.2     6.540    13.630     -33.5    17.470    27.930     -26.5    19.730    28.770     -52.0   -30.000    21.000     -54.0   -30.000    34.000     -76.0     9.860   121.000    -102.0    22.180   132.000    -171.0     3.730    19.000      -6.0     6.090    26.000     -62.0     5.000     -18.3     1.427     -65.2     0.000 -9.3e+061     5.000     -17.0     0.763      -5.5    0.33  0.68

alignment source: OPTM
            ---EEEEE------EEEEE----EEEEEE-----HHH-------EEEEE---------HHHHHHHHHH-----EEEEEEE
Query:   23 MPRSIRFTAEEGDLGFTLRGNAPVQVHFLDPYCSASVAGAREGDYIVSIQLVDCKWLTLSEVMKLLKSFGEDEIEMKVVS  102
Sbjct:    7 MPRLCRLVRGEQGYGFHLHGERGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAV-EGQTRLLVVD   85
            --EEEEEE-------EEEEE---EEEEEE----HHHH------EEEEEE--EE-----HHHHHHHHH-- --EEEEEEEE

            E-----
Query:  103 LLDEVT  108
Sbjct:   86 QEDTSV   91
            ------

85 residues (77.98%) of query sequence aligned



--> hit 2 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 16.87% helical, 39.76% extended, 43.37% loops/other (query: 11.93% 26.61% 61.47%)

  SCOP classification:  [All beta proteins]/[PDZ domain-like]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
b.36.1.1.1_A         b.36.1.1      101.79.79.75          GUESS   -26.104     0       1  73.39%  23.75%   OPTM     -342.206     -203.850        2.690        0.844        0.780        0.943        0.990     21.780     -33.9     4.250    73.000     -50.0    10.010    96.000    -145.0     1.320     4.400       5.9     1.320     2.160     -28.1     3.110    14.950      14.2     7.850    18.560     -34.8     8.540    25.030     -13.3    18.940    25.800     -50.2   -30.000    21.000     -49.0   -30.000    31.000     -72.0     5.910    90.000     -38.0    15.800   102.000    -132.0     2.590    14.000       8.0     7.030    26.000     -52.0     5.000     -10.7    -2.639     -35.6   -36.000     126.0     5.000     -10.7     5.000       5.0    0.34  0.64

alignment source: OPTM
            ---EEEEE--- ---EEEEE-- --EEEEEE-----HHH-------EEEEE---------HHHHHHHHHH-----EEEEE
Query:   23 MPRSIRFTAEE-GDLGFTLRGN-APVQVHFLDPYCSASVAGAREGDYIVSIQLVDCKWLTLSEVMKLLKSFGEDEIEMKV  100
Sbjct:  111 DPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTI  190
            --EEEEEE--------EEEEEE--EEEEEEE----HHHH-------EEEEE--EE-----HHHHHHHHHH----EEEEEE

            EE
Query:  101 VS  102
Sbjct:  191 RD  192
            E-

80 residues (73.39%) of query sequence aligned



--> hit 3 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 14.71% helical, 22.55% extended, 62.75% loops/other (query: 11.93% 26.61% 61.47%)

  SCOP classification:  [All beta proteins]/[PDZ domain-like]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1VAE_A               b.36.1.1      101.79.79.75          GUESS   -26.122     0       1  92.66%  70.59%   OPTM     -371.921     -220.700        6.713        0.716        0.849        0.821        0.892     45.550     -59.0    22.920   443.500    -440.5    40.980   434.500    -491.5     1.520     1.780     -17.0     1.660    -0.980     -23.2    15.060    58.900     -59.5    33.560    56.690     -79.8    12.640    35.960     -60.1    23.110    47.470     -78.1   -30.000    16.000     -69.0   -30.000    26.000     -82.0    22.280   403.000    -360.0    51.460   368.000    -403.0     6.810    45.000       8.0    10.000    41.000     -75.0     5.000     -41.0   -16.393     -20.8   -27.000     160.0     5.000     -41.0     5.000     -40.5    0.34  0.86

alignment source: OPTM
 +++ there is a problem with all-atom model, click here for details
            ------------------EEEEE------EEEEE----EEEEEE-----HHH-------EEEEE---------HHHHHHH
Query:    8 SSGVDLGTENLYFQSMPRSIRFTAEEGDLGFTLRGNAPVQVHFLDPYCSASVAGAREGDYIVSIQLVDCKWLTLSEVMKL   87
Sbjct:    1 GSSGSSGSASKRWSP-PRGIHFTVEEGDLGFTLRGNTPVQVHFLDPHCSASLAGAKEGDYIVSIQGVDCKWLTVSEVMKL   79
            -----------EE-- -----EE---------EE-----EE--------HHHHH-----EEEEE--EE-----HHHHHHH

            HHH-----EEEEEEEE------
Query:   88 LKSFGEDEIEMKVVSLLDEVTF  109
Sbjct:   80 LKSFGGEEVEMKVVSLLDSTSS  101
            HHH----EE-EEEE-EE-----

101 residues (92.66%) of query sequence aligned



--> hit 4 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 16.67% helical, 39.29% extended, 44.05% loops/other (query: 11.93% 26.61% 61.47%)

  SCOP classification:  [All beta proteins]/[PDZ domain-like]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
b.36.1.1.5_A         b.36.1.1      101.79.79.75          GUESS   -26.216     0       1  74.31%  23.46%   OPTM     -341.224     -196.570        2.931        0.771        0.744        0.934        0.979     23.010     -35.0     5.540    86.000     -71.5    10.410    99.500    -149.0     2.220     7.680      -1.2     1.290     2.160     -28.3     6.670    27.510      -1.8     8.810    18.860     -36.1    12.390    27.890     -22.3    18.050    26.270     -51.2   -30.000    21.000     -51.0   -30.000    32.000     -73.0     6.900    91.000     -54.0    16.880   106.000    -134.0     3.840    20.000      -1.0     7.770    29.000     -57.0     5.000     -10.7    -2.581     -35.6     0.000 -9.3e+061     5.000     -10.7     5.000       5.0    0.33  0.65

alignment source: OPTM
            ----EEEEE--- ---EEEEE-- --EEEEEE-----HHH-------EEEEE---------HHHHHHHHHH-----EEEE
Query:   22 SMPRSIRFTAEE-GDLGFTLRGN-APVQVHFLDPYCSASVAGAREGDYIVSIQLVDCKWLTLSEVMKLLKSFGEDEIEMK   99
Sbjct:  110 MDPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMT  189
            ---EEEEEE--------EEEEEE--EEEEEEE----HHHH-------EEEEE--EE-----HHHHHHHHHH----EEEEE

            EEE
Query:  100 VVS  102
Sbjct:  190 IRD  192
            EE-

81 residues (74.31%) of query sequence aligned



--> hit 5 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 18.42% helical, 34.21% extended, 47.37% loops/other (query: 11.93% 26.61% 61.47%)

  SCOP classification:  [All beta proteins]/[PDZ domain-like]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
b.36.1.1.14_A        b.36.1.1      101.79.79.75          GUESS   -26.222     0       1  70.64%  21.79%   OPTM     -342.261     -234.130        2.627        0.849        0.667        0.966        0.978     17.300     -29.1     1.860    35.000       4.5     4.400    37.000     -91.5     0.870    -1.880      12.9     1.570     2.850     -26.3     5.000    10.700      17.2     5.930    12.190     -29.7    12.360    23.640      -8.2    16.140    23.020     -45.9   -30.000    19.000     -39.0   -30.000    25.000     -67.0     7.830   119.000     -57.0    22.710   110.000    -148.0     1.100    12.000      23.0     4.640    23.000     -51.0     5.000     -13.5     3.130     -58.5     0.000 -9.3e+061     5.000     -13.5     0.940      -3.0    0.45  0.72

alignment source: OPTM
 +++ there is a problem with all-atom model, click here for details
            EEEE------EEEEE----EEEEEE-----HHH-------EEEEE---------HHHHHHHHHH-----EEEEEEEE-
Query:   27 IRFTAEEGDLGFTLRGNAPVQVHFLDPYCSASVAGAREGDYIVSIQLVDCKWLTLSEVMKLLKSFGEDEIEMKVVSLL  104
Sbjct:   19 ITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCP-SEIILLVWRMV   95
            -EEE-------EEEE-----EEEEE----HHHHH------EEEEE--EE-----HHHHHHHHH--- -EEEEEEE---

77 residues (70.64%) of query sequence aligned




DONE: Thu Aug 07 12:56:44 2008 EST

00%-10%	10%-20%	20%-30%	30%-40%	40%-50%	50%-60%	60%-70%	70%-80%	80%-90%	90%-100%
0	0	0	2	6	0	0	0	0	0