LOOPP results

LOOPP parallel driver v5.0 (06/13/08 15:45 EDT) with LOOPP v3.0 (compiled Jul 11 2008 17:20:20)
     [NEWSABLE]     [HSHFL]     [ENE]     [NEWALICHOICE]

This is HTML output, the other options are plain text, CASP AL and CASP TS formats.

If an error occured during execution it is logged in plain text version only,
there is no need to look for an error if this file ends with 'DONE' statement.

STARTING:Sat Aug 16 01:59:42 2008 EST

INPUT:
   sim_min =  40.0% minimum sequence identity (%)
   sim_max =  80.0% maximum sequence identity (%)
   len_dif =  20.0% maximum length difference (% of query sequence length) 
                    between query and homolog
   nmax    =  1     maximum number of homologous sequences (including query sequence)
   maxout  =  5     maximum number of outputted matches
   strict  =  0     all alignments will be accepted from LOOPP results
                    for homologs; they will be translated to query sequence 
                    alignments using BLAST results
   casp    =  5     maximum number of outputted matches in CASP format
   align   =  'g'   only corresponding global alignments will be reported
   maxdiff =  50.0% only alignments differing no more than  50.0% from the query
                    sequence will be reported, or when reject=0, corresponding local
                    alignments will be reported
   reject  =  1     alignments shorter more than  50.0% from the query sequence
                    will be rejected
   seccut  =  0.00  structures with sec. str. score below seccut will be rejected
    secdb  = 1      type of secondary structure description: 1 - DSSB, 0 - phi/psi map
   tasktb  = 11111111111111111111  type of initial calculations
   pdbcut  =  60.0% pdb sequence identity threshold (%)
  pdbstop  = 0      stop if PDB structure with similarity above pdbcut found
  domains  = 0      query sequence will be decomposed into putative domains if =1
   maxall  = 300      maximum number of models evaluated in the second stage       
   refstr  = 0      if equal to 1 rmsd distances between all hits and a reference structure
                   will be reported
   maxpdb  = 5      number of top PDB hits added to the second stage scoring 
   maxdyn  = 5      number of dynamic domain entries from database added to the second stage scoring 
 beautify  = 0      use pdb beautifier 
rmsdtables  = 1     compute rmsd tables between hits 

   local LOOPP/BLAST database will be used

   input file T0437
    --> 99 residues, sequence name: T0437
   Database: T:\CBSU\blastdb\20080108\nr


 -> 16 homolog sequences with sequence identity from  40.0% to  80.0% satisfying length constraints found
 -> 0 representatives will be used in search (nmax=1 including query sequence)
 Histogram of all homolog sequences found by BLAST (e-value cutoff 0.01, length constr.) by sequence identity:
  00%-10%    10%-20%    20%-30%    30%-40%    40%-50%    50%-60%    60%-70%    70%-80%    80%-90%    90%-100% 

       0          0          3         37         15          1          0          0          0          7   



RESULTS

secondary structure prediction shows 32.32% helical, 37.37% extended and 30.30% loops/other

homologs/domains used:
  0 query sequence T0437
all homologs found

total number of entries processed: 188

Amino acid profile calculated versus nr database is here
  (Amino acid profile BLAST run output is here)
Results of BLAST versus pdbaa database using the nr profile are here
  (Results of BLAST versus pdbaa database with no profile are here)
Transitive BLAST output calculted with this profile is here

Phase 1 scoring data: input and output
Phase 2 scoring data: input and output


HITS:

table legend
no    name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                               (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1    d.230.1.1.3_B        d.230.1.1     94.3.2.2                LOW   -24.249     0       1  63.64%   7.94%   OPTM     -235.442      -88.730        0.787        0.596        0.579        0.699        0.829      2.580     -16.8     0.810     9.000      14.0     0.570    -2.500     -47.0    -0.470    -3.190       6.1    -1.200    -0.070     -15.2    -0.610    -4.320      19.8    -0.300     0.100     -11.4     2.160    -3.090       5.2     5.500    -0.350     -21.3   -30.000     7.000     -25.0   -30.000    -3.000     -43.0     1.890    33.000      19.0     1.440    13.000     -40.0     2.250    24.000      -1.0     5.100    12.000     -45.0     5.000       0.3    -2.814     -64.5     0.000 -9.3e+061     5.000       0.3     5.000       5.0   -0.08  0.55
2    1MOG_A               d.230.2.1     94.3.1.1                LOW   -24.396     0       1  60.61%   8.33%   OPTM     -154.786      -75.010        0.804        0.481        0.294        0.857        0.951      0.770     -18.5     0.760     6.000      25.0     2.440     4.500     -70.0     0.670     0.630      17.6    -0.690     0.020     -15.3     0.470    -2.380      32.6    -0.260     0.040     -12.5     2.430     1.060      20.5     8.210     2.020     -26.1   -30.000     6.000     -23.0   -30.000     2.000     -48.0     1.330    16.000      36.0     2.370    -3.000     -47.0     1.350    10.000      28.0     4.840     8.000     -44.0     5.000      -0.5     0.661     -30.3   -23.000     120.0     5.000      -0.5    -0.796       0.6   -0.07  0.56
3    2JZ5_A               not_found     50.50.50.4              LOW   -24.494     0       1  74.75%  33.33%   OPTM     -299.750     -186.290        1.826        0.486        0.559        0.792        0.921      6.980     -25.1     4.250    47.000     -88.5     8.570    87.000    -156.5    -0.400     1.250      -8.0    -1.840    -3.960     -14.9     0.230    -1.110      -1.6     3.910    11.410     -23.5     1.870     9.500     -10.6    12.700     8.330     -37.2   -30.000    15.000     -42.0   -30.000     5.000     -56.0     5.440    59.000     -72.0    10.470    96.000    -144.0    -0.440     0.000      21.0     1.280     2.000     -35.0     5.000      -9.3    -1.087     -31.6     0.000 -9.3e+061     5.000      -9.3     5.000      -7.2   -0.26  0.54
4    2CZ8_A               not_found     50.50.50.4              LOW   -24.672     0       1  64.65%   7.81%   OPTM     -188.471      -92.460        0.689        0.377        0.258        0.863        0.899      1.950     -19.6     1.370    32.000      18.0    -0.650    -4.000     -40.0     2.060     8.000      11.9    -1.990    -1.510     -11.8     2.130     9.030      25.5    -1.260     0.960      -9.4     5.390     2.010      12.7     9.080     3.060     -26.8   -30.000    10.000     -26.0   -30.000     6.000     -51.0     0.520    -3.000      46.0    -0.740    -3.000     -29.0     2.400    17.000      29.0     3.650     1.000     -33.0     5.000       0.1     3.100     -41.9     0.000 -9.3e+061     5.000       0.1     5.000       0.7   -0.03  0.40
5    2JXT_A               not_found     50.50.50.4              LOW   -24.802     0       1  64.65%  14.93%   OPTM     -212.150      -71.750        0.862        0.553        0.235        0.696        0.878      0.090     -20.2     2.810    40.000     -31.0     0.370    13.000     -50.5    -0.740    -3.050      -3.1    -0.560     0.170     -17.2    -0.220     0.220       6.0     0.450    -0.220     -14.3     5.880     3.460     -15.8     7.520     2.570     -27.4   -30.000     0.000     -42.0   -30.000     3.000     -54.0     1.970    34.000      -3.0     0.450     8.000     -37.0     0.730    -5.000      22.0     3.730    -2.000     -40.0     5.000       5.0     0.607     -45.6     0.000 -9.3e+061     5.000       5.0     5.000       5.0    0.28  0.67



RMSD table between hits
(RMSDs are shaded according to similarity, up to 10Å )

	1	2	3	4	5
1	0.00	7.89	7.28	9.25	6.53
2	7.89	0.00	7.09	2.96	4.76
3	7.28	7.09	0.00	8.39	7.00
4	9.25	2.96	8.39	0.00	5.91
5	6.53	4.76	7.00	5.91	0.00



Similarity table for hits: percentage of chain fitting below 3Å RMSD
(Cells are shaded according to similarity starting at 30%)

	1	2	3	4	5
1	100.00	33.90	28.57	32.79	36.54
2	33.90	100.00	36.67	100.00	75.00
3	28.57	36.67	100.00	37.50	40.38
4	32.79	100.00	37.50	100.00	70.00
5	36.54	75.00	40.38	70.00	100.00



Similarity table for hits: percentage of chain fitting below 6Å RMSD
(Cells are shaded according to similarity starting at 50%)

	1	2	3	4	5
1	100.00	61.02	53.97	60.66	78.85
2	61.02	100.00	83.33	100.00	100.00
3	53.97	83.33	100.00	78.13	90.38
4	60.66	100.00	78.13	100.00	100.00
5	78.85	100.00	90.38	100.00	100.00





ALIGNMENTS

--> hit 1 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 17.81% helical, 45.21% extended, 36.99% loops/other (query: 32.32% 37.37% 30.30%)

  SCOP classification:  [Alpha and beta proteins (a+b)]/[Dodecin subunit-like]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
d.230.1.1.3_B        d.230.1.1     94.3.2.2                LOW   -24.249     0       1  63.64%   7.94%   OPTM     -235.442      -88.730        0.787        0.596        0.579        0.699        0.829      2.580     -16.8     0.810     9.000      14.0     0.570    -2.500     -47.0    -0.470    -3.190       6.1    -1.200    -0.070     -15.2    -0.610    -4.320      19.8    -0.300     0.100     -11.4     2.160    -3.090       5.2     5.500    -0.350     -21.3   -30.000     7.000     -25.0   -30.000    -3.000     -43.0     1.890    33.000      19.0     1.440    13.000     -40.0     2.250    24.000      -1.0     5.100    12.000     -45.0     5.000       0.3    -2.814     -64.5     0.000 -9.3e+061     5.000       0.3     5.000       5.0   -0.08  0.55

alignment source: OPTM
            -----EEEEEEE---HHHHHHHHHHHHHHHHHHH------     EEEEEEEE--        --EEEEEEEEEEE
Query:   22 DNDNCTSKFSRFFATREEAESFMTKLKELAAAASSADEGA-----SVAYKIKDLE--------GQVELDAAFTFSC   84
Sbjct:    1 MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIV   76
            --EEEEEEEEEEE--------HHHHHHHHHHHHH---EE---EEEEEEEEEEEE-----------EEEEEEEEEEE

63 residues (63.64%) of query sequence aligned



--> hit 2 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 22.73% helical, 50.00% extended, 27.27% loops/other (query: 32.32% 37.37% 30.30%)

  SCOP classification:  [Alpha and beta proteins (a+b)]/[Dodecin subunit-like]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1MOG_A               d.230.2.1     94.3.1.1                LOW   -24.396     0       1  60.61%   8.33%   OPTM     -154.786      -75.010        0.804        0.481        0.294        0.857        0.951      0.770     -18.5     0.760     6.000      25.0     2.440     4.500     -70.0     0.670     0.630      17.6    -0.690     0.020     -15.3     0.470    -2.380      32.6    -0.260     0.040     -12.5     2.430     1.060      20.5     8.210     2.020     -26.1   -30.000     6.000     -23.0   -30.000     2.000     -48.0     1.330    16.000      36.0     2.370    -3.000     -47.0     1.350    10.000      28.0     4.840     8.000     -44.0     5.000      -0.5     0.661     -30.3   -23.000     120.0     5.000      -0.5    -0.796       0.6   -0.07  0.56

alignment source: OPTM
            -EEEEEEE---HHHHHHHHHHHHHHHHHHH------EEEEEEEE---  -EEEEEEEEEEEE
Query:   26 CTSKFSRFFATREEAESFMTKLKELAAAASSADEGASVAYKIKDLEG--QVELDAAFTFSCQ   85
Sbjct:    2 VFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEERTYQTEVQVAFE   63
            -EEEEEEEEEE---HHHHHHHHHHHHHHH---EEEEEEEEEEEE-------EEEEEEEEEEE

60 residues (60.61%) of query sequence aligned



--> hit 3 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 38.55% helical, 20.48% extended, 40.96% loops/other (query: 32.32% 37.37% 30.30%)

  SCOP classification: 


 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
2JZ5_A               not_found     50.50.50.4              LOW   -24.494     0       1  74.75%  33.33%   OPTM     -299.750     -186.290        1.826        0.486        0.559        0.792        0.921      6.980     -25.1     4.250    47.000     -88.5     8.570    87.000    -156.5    -0.400     1.250      -8.0    -1.840    -3.960     -14.9     0.230    -1.110      -1.6     3.910    11.410     -23.5     1.870     9.500     -10.6    12.700     8.330     -37.2   -30.000    15.000     -42.0   -30.000     5.000     -56.0     5.440    59.000     -72.0    10.470    96.000    -144.0    -0.440     0.000      21.0     1.280     2.000     -35.0     5.000      -9.3    -1.087     -31.6     0.000 -9.3e+061     5.000      -9.3     5.000      -7.2   -0.26  0.54

alignment source: OPTM
 +++ there is a problem with all-atom model, click here for details
            -----EEEEEEE---HHHHHHHHHHHHHHHHHHH------EEEEEEEE----E EEEEEEEEEEEEEHHHHHHHHHHH-
Query:   22 DNDNCTSKFSRFFATREEAESFMTKLKELAAAASSADEGASVAYKIKDLEGQV-ELDAAFTFSCQAEMIIFELSLRSLA   99
Sbjct:    9 KEGDEVADVTIFAETKDALESELAKYIELAKSVCAG-----VEYNVSELTEESKELTARFKFEVSAEKLIFELKTRSLA   82
            ----EEEEEEE---HHHHHHHHHHHHHHHHHH----     EEE---------EEEEEEE---HHHHHHHHHHHHHH--

74 residues (74.75%) of query sequence aligned



--> hit 4 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 22.73% helical, 57.58% extended, 19.70% loops/other (query: 32.32% 37.37% 30.30%)

  SCOP classification: 


 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
2CZ8_A               not_found     50.50.50.4              LOW   -24.672     0       1  64.65%   7.81%   OPTM     -188.471      -92.460        0.689        0.377        0.258        0.863        0.899      1.950     -19.6     1.370    32.000      18.0    -0.650    -4.000     -40.0     2.060     8.000      11.9    -1.990    -1.510     -11.8     2.130     9.030      25.5    -1.260     0.960      -9.4     5.390     2.010      12.7     9.080     3.060     -26.8   -30.000    10.000     -26.0   -30.000     6.000     -51.0     0.520    -3.000      46.0    -0.740    -3.000     -29.0     2.400    17.000      29.0     3.650     1.000     -33.0     5.000       0.1     3.100     -41.9     0.000 -9.3e+061     5.000       0.1     5.000       0.7   -0.03  0.40

alignment source: OPTM
            ---EEEEEEE---HHHHHHHHHHHHHHHHHHH------EEEEEEEE----EEEEEEEEEEEEEE
Query:   24 DNCTSKFSRFFATREEAESFMTKLKELAAAASSADEGASVAYKIKDLEGQVELDAAFTFSCQAE   87
Sbjct:    2 GKVYKKVELVGTSEEGLEAAIQAALARARKTLRHLDWFEVKEIRGTIGEAGVKEYQVVLEVGFR   65
            ---EEEEEEEEEE---HHHHHHHHHHHHHHH---EEEEEEEEEEEEEE--EEEEEEEEEEEEEE

64 residues (64.65%) of query sequence aligned



--> hit 5 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 22.86% helical, 44.29% extended, 32.86% loops/other (query: 32.32% 37.37% 30.30%)

  SCOP classification: 


 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
2JXT_A               not_found     50.50.50.4              LOW   -24.802     0       1  64.65%  14.93%   OPTM     -212.150      -71.750        0.862        0.553        0.235        0.696        0.878      0.090     -20.2     2.810    40.000     -31.0     0.370    13.000     -50.5    -0.740    -3.050      -3.1    -0.560     0.170     -17.2    -0.220     0.220       6.0     0.450    -0.220     -14.3     5.880     3.460     -15.8     7.520     2.570     -27.4   -30.000     0.000     -42.0   -30.000     3.000     -54.0     1.970    34.000      -3.0     0.450     8.000     -37.0     0.730    -5.000      22.0     3.730    -2.000     -40.0     5.000       5.0     0.607     -45.6     0.000 -9.3e+061     5.000       5.0     5.000       5.0    0.28  0.67

alignment source: OPTM
            -------EEEEEEEE-----EEEEEEE---HHHHHHHHHHHHHHHHHHH------EEEEEEEE----
Query:    7 KCSTKGCAIDIGTVIDNDNCTSKFSRFFATREEAESFMTKLKELAAAASSADEGASVAYKIKDLEGQ   73
Sbjct:    2 KMKTKIFRVKGKFLMG-DKLQPFTKELNAIRE--EEIYERLYSEFGSKHRVPRSKVKIEEIEEISPE   65
            ---EEEEEEEEEEE-- EEEEEEEEEEE--HH  HHHHHHHHHHHHH-------EEEEEEEEE----

64 residues (64.65%) of query sequence aligned




DONE: Sat Aug 16 04:06:34 2008 EST

00%-10%	10%-20%	20%-30%	30%-40%	40%-50%	50%-60%	60%-70%	70%-80%	80%-90%	90%-100%
0	0	3	37	15	1	0	0	0	7