LOOPP results

LOOPP parallel driver v5.0 (06/13/08 15:45 EDT) with LOOPP v3.0 (compiled Jul 11 2008 17:20:20)
     [NEWSABLE]     [HSHFL]     [ENE]     [NEWALICHOICE]

This is HTML output, the other options are plain text, CASP AL and CASP TS formats.

If an error occured during execution it is logged in plain text version only,
there is no need to look for an error if this file ends with 'DONE' statement.

STARTING:Sat Aug 16 02:14:40 2008 EST

INPUT:
   sim_min =  40.0% minimum sequence identity (%)
   sim_max =  80.0% maximum sequence identity (%)
   len_dif =  20.0% maximum length difference (% of query sequence length) 
                    between query and homolog
   nmax    =  1     maximum number of homologous sequences (including query sequence)
   maxout  =  5     maximum number of outputted matches
   strict  =  0     all alignments will be accepted from LOOPP results
                    for homologs; they will be translated to query sequence 
                    alignments using BLAST results
   casp    =  5     maximum number of outputted matches in CASP format
   align   =  'g'   only corresponding global alignments will be reported
   maxdiff =  50.0% only alignments differing no more than  50.0% from the query
                    sequence will be reported, or when reject=0, corresponding local
                    alignments will be reported
   reject  =  1     alignments shorter more than  50.0% from the query sequence
                    will be rejected
   seccut  =  0.00  structures with sec. str. score below seccut will be rejected
    secdb  = 1      type of secondary structure description: 1 - DSSB, 0 - phi/psi map
   tasktb  = 11111111111111111111  type of initial calculations
   pdbcut  =  60.0% pdb sequence identity threshold (%)
  pdbstop  = 0      stop if PDB structure with similarity above pdbcut found
  domains  = 0      query sequence will be decomposed into putative domains if =1
   maxall  = 300      maximum number of models evaluated in the second stage       
   refstr  = 0      if equal to 1 rmsd distances between all hits and a reference structure
                   will be reported
   maxpdb  = 5      number of top PDB hits added to the second stage scoring 
   maxdyn  = 5      number of dynamic domain entries from database added to the second stage scoring 
 beautify  = 0      use pdb beautifier 
rmsdtables  = 1     compute rmsd tables between hits 

   local LOOPP/BLAST database will be used

   input file T0458
    --> 107 residues, sequence name: T0458
   Database: T:\CBSU\blastdb\20080108\nr


 -> 82 homolog sequences with sequence identity from  40.0% to  80.0% satisfying length constraints found
 -> 0 representatives will be used in search (nmax=1 including query sequence)
 Histogram of all homolog sequences found by BLAST (e-value cutoff 0.01, length constr.) by sequence identity:
  00%-10%    10%-20%    20%-30%    30%-40%    40%-50%    50%-60%    60%-70%    70%-80%    80%-90%    90%-100% 

       0          0          1          5         30         48          3          1          0          1   

2 dynamic database entries created: 2OKA_A 2NPB_A 




RESULTS

secondary structure prediction shows 25.23% helical, 20.56% extended and 54.21% loops/other

homologs/domains used:
  0 query sequence T0458
all homologs found

total number of entries processed: 281

Amino acid profile calculated versus nr database is here
  (Amino acid profile BLAST run output is here)
Results of BLAST versus pdbaa database using the nr profile are here
  (Results of BLAST versus pdbaa database with no profile are here)
Transitive BLAST output calculted with this profile is here

Phase 1 scoring data: input and output
Phase 2 scoring data: input and output


HITS:

table legend
no    name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                               (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1    2OJL_A               not_found     111.111.111.19           LOW   -24.515     0       1  72.90%  55.13%   OPTM     -485.852     -295.710        5.467        0.944        0.951        0.977        0.977     25.640     -40.5    14.010   241.500    -217.0    25.240   263.500    -306.5     2.640    10.360       7.7     6.360     9.450     -29.8    11.880    39.640      -7.3    29.930    45.100     -58.0    12.980    26.700     -12.7    25.690    30.520     -57.8   -30.000     5.000     -32.0   -30.000     6.000     -61.0    18.820   299.000    -243.0    47.250   319.000    -350.0    -0.740     7.000      24.0     5.930    19.000     -54.0     5.000     -37.5    -7.757     -38.6     0.000 -9.3e+061     5.000     -42.5     0.940     -14.5    0.05  0.59
2    2OKA_A               not_found     111.111.111.19           LOW   -24.550     0       1  77.57%  53.01%   OPTM     -497.976     -400.340        6.390        0.902        0.945        0.977        0.989     31.580     -46.2    16.790   280.500    -254.0    29.850   281.500    -324.5     4.760    11.290      -4.6     4.900     8.130     -28.9    19.890    57.520     -34.0    27.610    49.580     -65.3    20.590    34.930     -38.3    28.470    36.100     -65.5   -30.000     4.000     -44.0   -30.000     6.000     -68.0    24.140   358.000    -291.0    52.260   333.000    -366.0     1.300    18.000       1.0     9.070    26.000     -65.0     5.000     -41.7   -14.156     -34.3     0.000 -9.3e+061     5.000     -41.7     0.041     -14.5    0.02  0.61
3    2OBK_A               not_found     111.111.111.19           LOW   -24.810     0       1  77.57%  49.40%   OPTM     -494.606     -398.650        5.854        0.898        0.964        0.978        0.990     29.250     -44.7    14.400   263.500    -228.0    29.770   255.500    -306.0    -0.200     4.630      15.6     5.680     8.800     -30.8    -0.380     4.100      32.9    29.260    48.240     -64.7     1.600     6.780      13.4    28.920    35.890     -65.3   -30.000     4.000     -44.0   -30.000     6.000     -68.0    21.140   360.000    -284.0    53.880   329.000    -362.0     1.610    14.000      -3.0     7.320    29.000     -65.0     5.000     -42.5   -11.752     -32.1     0.000 -9.3e+061     5.000     -47.3     0.230     -16.5    0.02  0.61
4    2P0G_A               not_found     111.111.111.19           LOW   -24.873     0       1  71.96%  45.45%   OPTM     -529.730     -282.530        5.166        0.881        0.937        0.974        0.974     22.240     -37.8    10.160   174.500    -133.0    22.110   219.000    -263.0     0.860     0.910      18.7     4.530     6.930     -26.4     0.380    -3.140      38.0    20.910    38.700     -53.0     0.360     0.490      26.2    23.710    27.320     -54.4   -30.000     3.000     -30.0   -30.000     4.000     -58.0    16.590   281.000    -209.0    57.580   317.000    -349.0    -0.820     4.000      23.0     8.030    25.000     -61.0     5.000     -35.3    -7.401     -38.7     0.000 -9.3e+061     5.000     -42.5    -0.108     -14.0   -0.05  0.55
5    2FA8_A               c.47.1.23     19.16.15.3              LOW   -24.921     0       1  79.44%  47.06%   OPTM     -537.263     -354.100        6.051        0.879        0.948        0.981        0.981     27.860     -42.3    15.210   273.500    -242.5    27.450   272.500    -321.5     4.140     7.270      -1.1     5.300     7.480     -27.5    17.190    45.130     -25.3    27.110    45.410     -58.3    17.750    27.910     -33.6    23.600    30.730     -60.5   -30.000     5.000     -45.0   -30.000     6.000     -67.0    24.620   360.000    -302.0    52.240   336.000    -368.0     0.600     0.000       6.0     5.630    19.000     -53.0     5.000     -41.4    -8.432     -35.6     0.000 -9.3e+061     5.000     -45.2     1.279     -13.4    0.06  0.68



RMSD table between hits
(RMSDs are shaded according to similarity, up to 10Å )

	1	2	3	4	5
1	0.00	0.60	0.63	0.77	0.54
2	0.60	0.00	0.59	0.73	0.50
3	0.63	0.59	0.00	0.69	0.54
4	0.77	0.73	0.69	0.00	0.67
5	0.54	0.50	0.54	0.67	0.00



Similarity table for hits: percentage of chain fitting below 3Å RMSD
(Cells are shaded according to similarity starting at 30%)

	1	2	3	4	5
1	100.00	100.00	100.00	100.00	100.00
2	100.00	100.00	100.00	100.00	100.00
3	100.00	100.00	100.00	100.00	100.00
4	100.00	100.00	100.00	100.00	100.00
5	100.00	100.00	100.00	100.00	100.00



Similarity table for hits: percentage of chain fitting below 6Å RMSD
(Cells are shaded according to similarity starting at 50%)

	1	2	3	4	5
1	100.00	100.00	100.00	100.00	100.00
2	100.00	100.00	100.00	100.00	100.00
3	100.00	100.00	100.00	100.00	100.00
4	100.00	100.00	100.00	100.00	100.00
5	100.00	100.00	100.00	100.00	100.00





ALIGNMENTS

--> hit 1 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 35.06% helical, 31.17% extended, 33.77% loops/other (query: 25.23% 20.56% 54.21%)

  SCOP classification: 


 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
2OJL_A               not_found     111.111.111.19           LOW   -24.515     0       1  72.90%  55.13%   OPTM     -485.852     -295.710        5.467        0.944        0.951        0.977        0.977     25.640     -40.5    14.010   241.500    -217.0    25.240   263.500    -306.5     2.640    10.360       7.7     6.360     9.450     -29.8    11.880    39.640      -7.3    29.930    45.100     -58.0    12.980    26.700     -12.7    25.690    30.520     -57.8   -30.000     5.000     -32.0   -30.000     6.000     -61.0    18.820   299.000    -243.0    47.250   319.000    -350.0    -0.740     7.000      24.0     5.930    19.000     -54.0     5.000     -37.5    -7.757     -38.6     0.000 -9.3e+061     5.000     -42.5     0.940     -14.5    0.05  0.59

alignment source: OPTM
            ---EEEEEE-------HHHHHHHHHHHHH--HHH--EEEE-----EEEEEE--EEEEEE---- ---HHHHHHHHHHH-
Query:   11 HTHRVQIEYCTQCRWLPRAAWLAQELLTTFETELTELALKPGTGGVFVVRVDDEVVWDRREQG-FPEPTAVKRLVRDRV   88
Sbjct:    7 HPPRIAIQYCTQCQWLLRAAW-AQELLSTFGADLGEVALVPGTGGVFRIHYNGAPLWDREVDGGFPEAKVLKQRVRDHL   84
            ---EEEEEEE-----HHHHH- -HHHHHHH-----EEEEEEE----EEEEE--EEEEEHHHH-----HHHHHHHHHHH-

78 residues (72.90%) of query sequence aligned



--> hit 2 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 36.14% helical, 28.92% extended, 34.94% loops/other (query: 25.23% 20.56% 54.21%)

  SCOP classification: 


 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
2OKA_A               not_found     111.111.111.19           LOW   -24.550     0       1  77.57%  53.01%   OPTM     -497.976     -400.340        6.390        0.902        0.945        0.977        0.989     31.580     -46.2    16.790   280.500    -254.0    29.850   281.500    -324.5     4.760    11.290      -4.6     4.900     8.130     -28.9    19.890    57.520     -34.0    27.610    49.580     -65.3    20.590    34.930     -38.3    28.470    36.100     -65.5   -30.000     4.000     -44.0   -30.000     6.000     -68.0    24.140   358.000    -291.0    52.260   333.000    -366.0     1.300    18.000       1.0     9.070    26.000     -65.0     5.000     -41.7   -14.156     -34.3     0.000 -9.3e+061     5.000     -41.7     0.041     -14.5    0.02  0.61

alignment source: OPTM
            ---EEEEEE-------HHHHHHHHHHHHH--HHH--EEEE-----EEEEEE--EEEEEE--- ----HHHHHHHHHHH--
Query:   11 HTHRVQIEYCTQCRWLPRAAWLAQELLTTFETELTELALKPGTGGVFVVRVDDEVVWDRREQ-GFPEPTAVKRLVRDRVA   89
Sbjct:    4 AKPEIVITYCTQCQWLLRAAWLAQELLSTFADDLGKVCLEPGTGGVFRITCDGVQVWERKADGGFPEAKALKQRVRDRID   83
            ---EEEEEEE-----HHHHHHHHHHHHHH------EEEEEEE----EEEEE--EEEEEHHHH-----HHHHHHHHHHHH-

            ----
Query:   90 PEKS   93
Sbjct:   84 PQRD   87
            ----

83 residues (77.57%) of query sequence aligned



--> hit 3 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 36.14% helical, 28.92% extended, 34.94% loops/other (query: 25.23% 20.56% 54.21%)

  SCOP classification: 


 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
2OBK_A               not_found     111.111.111.19           LOW   -24.810     0       1  77.57%  49.40%   OPTM     -494.606     -398.650        5.854        0.898        0.964        0.978        0.990     29.250     -44.7    14.400   263.500    -228.0    29.770   255.500    -306.0    -0.200     4.630      15.6     5.680     8.800     -30.8    -0.380     4.100      32.9    29.260    48.240     -64.7     1.600     6.780      13.4    28.920    35.890     -65.3   -30.000     4.000     -44.0   -30.000     6.000     -68.0    21.140   360.000    -284.0    53.880   329.000    -362.0     1.610    14.000      -3.0     7.320    29.000     -65.0     5.000     -42.5   -11.752     -32.1     0.000 -9.3e+061     5.000     -47.3     0.230     -16.5    0.02  0.61

alignment source: OPTM
            ---EEEEEE-------HHHHHHHHHHHHH--HHH--EEEE-----EEEEEE--EEEEEE--- ----HHHHHHHHHHH--
Query:   11 HTHRVQIEYCTQCRWLPRAAWLAQELLTTFETELTELALKPGTGGVFVVRVDDEVVWDRREQ-GFPEPTAVKRLVRDRVA   89
Sbjct:    4 RKPEVIITYCTQCQWLLRAAWLAQELLSTFSDDLGKVSLEPATGGAFRITCDGVQIWERKADGGFPEAKVLKQRVRDQID   83
            ---EEEEEEE-----HHHHHHHHHHHHHH------EEEEEEE----EEEEE--EEEEEHHHH-----HHHHHHHHHHHH-

            ----
Query:   90 PEKS   93
Sbjct:   84 PERD   87
            ----

83 residues (77.57%) of query sequence aligned



--> hit 4 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 32.89% helical, 35.53% extended, 31.58% loops/other (query: 25.23% 20.56% 54.21%)

  SCOP classification: 


 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
2P0G_A               not_found     111.111.111.19           LOW   -24.873     0       1  71.96%  45.45%   OPTM     -529.730     -282.530        5.166        0.881        0.937        0.974        0.974     22.240     -37.8    10.160   174.500    -133.0    22.110   219.000    -263.0     0.860     0.910      18.7     4.530     6.930     -26.4     0.380    -3.140      38.0    20.910    38.700     -53.0     0.360     0.490      26.2    23.710    27.320     -54.4   -30.000     3.000     -30.0   -30.000     4.000     -58.0    16.590   281.000    -209.0    57.580   317.000    -349.0    -0.820     4.000      23.0     8.030    25.000     -61.0     5.000     -35.3    -7.401     -38.7     0.000 -9.3e+061     5.000     -42.5    -0.108     -14.0   -0.05  0.55

alignment source: OPTM
            --EEEEEE-------HHHHHHHHHHHHH--HHH--EEEE-----EEEEEE--EEEEEE--- ----HHHHHHHHHHH-
Query:   12 THRVQIEYCTQCRWLPRAAWLAQELLTTFETELTELALKPGTGGVFVVRVDDEVVWDRREQ-GFPEPTAVKRLVRDRV   88
Sbjct:    3 KAQIEIYYCRQCNWL-RSAWLSQELLHTFSEEIEYVALHPDTGGRFEIFCNGVQIWERKQEGGFPEAKVLKQRVRDLI   79
            -EEEEEEEE------ HHHHHHHHHHHH----EEEEEEEEE----EEEEE--EEEEEHHHH-----HHHHHHHHH---

77 residues (71.96%) of query sequence aligned



--> hit 5 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 33.33% helical, 28.57% extended, 38.10% loops/other (query: 25.23% 20.56% 54.21%)

  SCOP classification:  [Alpha and beta proteins (a/b)]/[Thioredoxin fold]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
2FA8_A               c.47.1.23     19.16.15.3              LOW   -24.921     0       1  79.44%  47.06%   OPTM     -537.263     -354.100        6.051        0.879        0.948        0.981        0.981     27.860     -42.3    15.210   273.500    -242.5    27.450   272.500    -321.5     4.140     7.270      -1.1     5.300     7.480     -27.5    17.190    45.130     -25.3    27.110    45.410     -58.3    17.750    27.910     -33.6    23.600    30.730     -60.5   -30.000     5.000     -45.0   -30.000     6.000     -67.0    24.620   360.000    -302.0    52.240   336.000    -368.0     0.600     0.000       6.0     5.630    19.000     -53.0     5.000     -41.4    -8.432     -35.6     0.000 -9.3e+061     5.000     -45.2     1.279     -13.4    0.06  0.68

alignment source: OPTM
            ---EEEEEE-------HHHHHHHHHHHHH--HHH--EEEE-----EEEEEE--EEEEEE--- ----HHHHHHHHHHH--
Query:   11 HTHRVQIEYCTQCRWLPRAAWLAQELLTTFETELTELALKPGTGGVFVVRVDDEVVWDRREQ-GFPEPTAVKRLVRDRVA   89
Sbjct:    4 TKPRIAIRYCTQCNWLLRAGW-AQEILQTFASDIGEVSLIPSTGGLFEITVDGTIIWERKRDGGFPGPKELKQRIRDLID   82
            ---EEEEEEE-----HHHHH- -HHHHHHH-----EEEEEEE----EEEEE--EEEEEHHHH-----HHHHHHHHHHHH-

            ------
Query:   90 PEKSLG   95
Sbjct:   83 PERDLG   88
            ------

85 residues (79.44%) of query sequence aligned




DONE: Sat Aug 16 05:33:39 2008 EST

00%-10%	10%-20%	20%-30%	30%-40%	40%-50%	50%-60%	60%-70%	70%-80%	80%-90%	90%-100%
0	0	1	5	30	48	3	1	0	1