LOOPP results

LOOPP parallel driver v5.0 (06/13/08 15:45 EDT) with LOOPP v3.0 (compiled Jul 11 2008 17:20:20)
     [NEWSABLE]     [HSHFL]     [ENE]     [NEWALICHOICE]

This is HTML output, the other options are plain text, CASP AL and CASP TS formats.

If an error occured during execution it is logged in plain text version only,
there is no need to look for an error if this file ends with 'DONE' statement.

STARTING:Sat Aug 16 05:35:09 2008 EST

INPUT:
   sim_min =  40.0% minimum sequence identity (%)
   sim_max =  80.0% maximum sequence identity (%)
   len_dif =  20.0% maximum length difference (% of query sequence length) 
                    between query and homolog
   nmax    =  1     maximum number of homologous sequences (including query sequence)
   maxout  =  5     maximum number of outputted matches
   strict  =  0     all alignments will be accepted from LOOPP results
                    for homologs; they will be translated to query sequence 
                    alignments using BLAST results
   casp    =  5     maximum number of outputted matches in CASP format
   align   =  'g'   only corresponding global alignments will be reported
   maxdiff =  50.0% only alignments differing no more than  50.0% from the query
                    sequence will be reported, or when reject=0, corresponding local
                    alignments will be reported
   reject  =  1     alignments shorter more than  50.0% from the query sequence
                    will be rejected
   seccut  =  0.00  structures with sec. str. score below seccut will be rejected
    secdb  = 1      type of secondary structure description: 1 - DSSB, 0 - phi/psi map
   tasktb  = 11111111111111111111  type of initial calculations
   pdbcut  =  60.0% pdb sequence identity threshold (%)
  pdbstop  = 0      stop if PDB structure with similarity above pdbcut found
  domains  = 0      query sequence will be decomposed into putative domains if =1
   maxall  = 300      maximum number of models evaluated in the second stage       
   refstr  = 0      if equal to 1 rmsd distances between all hits and a reference structure
                   will be reported
   maxpdb  = 5      number of top PDB hits added to the second stage scoring 
   maxdyn  = 5      number of dynamic domain entries from database added to the second stage scoring 
 beautify  = 0      use pdb beautifier 
rmsdtables  = 1     compute rmsd tables between hits 

   local LOOPP/BLAST database will be used

   input file T0459
    --> 111 residues, sequence name: T0459
   Database: T:\CBSU\blastdb\20080108\nr


 -> 5 homolog sequences with sequence identity from  40.0% to  80.0% satisfying length constraints found
 -> 0 representatives will be used in search (nmax=1 including query sequence)
 Histogram of all homolog sequences found by BLAST (e-value cutoff 0.01, length constr.) by sequence identity:
  00%-10%    10%-20%    20%-30%    30%-40%    40%-50%    50%-60%    60%-70%    70%-80%    80%-90%    90%-100% 

       0          0         26        116          4          1          0          0          0          2   

2 dynamic database entries created: 2PFB_A 2P4W_A 




RESULTS

secondary structure prediction shows 51.35% helical,  8.11% extended and 40.54% loops/other

homologs/domains used:
  0 query sequence T0459
all homologs found

total number of entries processed: 270

Amino acid profile calculated versus nr database is here
  (Amino acid profile BLAST run output is here)
Results of BLAST versus pdbaa database using the nr profile are here
  (Results of BLAST versus pdbaa database with no profile are here)
Transitive BLAST output calculted with this profile is here

Phase 1 scoring data: input and output
Phase 2 scoring data: input and output


HITS:

table legend
no    name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                               (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1    a.4.5.6.1_A          a.4.5.6       102.85.83.1           GUESS   -26.687     0       1  50.45%  19.64%   OPTM     -227.669     -149.300        0.758        0.799        0.529        0.714        0.929      8.960     -19.6     0.610    -6.000      40.5    -0.370   -22.000     -44.5    -0.450     0.750      21.0     0.090     1.310     -18.3    -0.640     1.530      36.4    -0.070     1.430     -14.6     6.150    11.160      10.5     6.940     4.950     -28.5   -30.000    10.000     -29.0   -30.000    17.000     -60.0     2.050    21.000      26.0     3.840    26.000     -56.0     0.610     2.000      48.0     0.470    -4.000     -29.0     5.000      -0.3    -0.138     -46.1     0.000      90.0     5.000      -0.3     5.000       5.0    0.18  0.87
2    1XMK_A               a.4.5.19      102.85.83.2           GUESS   -26.755     0       1  56.76%  18.75%   OPTM     -227.483     -117.680        0.683        0.835        0.629        0.776        0.951      7.620     -19.3     0.960     6.500      17.0     0.270     8.500     -54.5     0.770     3.070      17.3    -0.210    -1.430     -16.3     0.970     1.140      30.3     0.130    -1.810     -13.3     6.200     4.660       3.7     8.460     7.610     -33.8   -30.000    14.000     -40.0   -30.000    13.000     -59.0     0.960    18.000      36.0     0.520     8.000     -36.0    -0.020     4.000      44.0     1.280     1.000     -32.0     5.000      -1.7    -2.348     -34.9     0.000 -9.3e+061     5.000      -1.7     5.000       5.0    0.26  0.85
3    a.4.5.11.1_B         a.4.5.11      102.85.83.4           GUESS   -26.989     0       1  61.26%  18.84%   OPTM     -270.420     -181.960        0.698        0.691        0.671        0.819        0.898      7.000     -17.0     0.550    -4.000      39.5     0.850    10.000     -54.0    -0.220     1.570      22.8     0.040    -1.040     -15.9     1.490     4.910      35.0     1.910     2.680     -14.7     5.530    10.930       9.3     6.470     6.010     -29.3   -30.000    16.000     -32.0   -30.000    11.000     -51.0     0.890   -11.000      52.0     1.510     2.000     -40.0     0.500     3.000      39.0     1.190    -2.000     -35.0     5.000      -0.5     4.536     -55.4     4.000      88.0     5.000      -0.5     5.000       5.0    0.35  0.74
4    2FU4_A               not_found     79.79.79.33           GUESS   -27.050     0       1  63.96%  22.54%   OPTM     -295.346     -137.580        0.792        0.774        0.443        0.818        0.925     11.180     -21.8     1.160    18.500       0.5     2.190     6.000     -72.5    -0.360    -1.140      15.3    -0.780    -0.940     -15.2     0.120    -2.760      27.0    -0.440     1.100     -12.6     5.510     8.570       2.1     6.780     7.860     -31.1   -30.000    -3.000     -27.0   -30.000    13.000     -58.0     0.070    -6.000      38.0     3.500    21.000     -58.0    -0.570    -4.000      40.0     1.220    -3.000     -35.0     5.000      -1.8    -0.341     -35.8     0.000 -9.3e+061     5.000      -1.8     5.000       5.0    0.59  0.89
5    1LDD_A               a.4.5.34      102.85.83.2           GUESS   -27.083     0       1  56.76%  15.87%   OPTM     -259.329     -116.900        0.388        0.699        0.485        0.794        0.920      7.110     -17.9    -1.400   -20.000      49.5    -1.060    -2.000     -48.0    -0.130    -1.280      22.2    -1.060    -2.660     -13.9    -0.470    -0.860      37.8     0.320     0.320     -13.5     1.660    -4.490      18.5     4.220    -1.210     -26.1   -30.000   -10.000     -21.0   -30.000     6.000     -51.0    -1.260   -28.000      59.0     0.930     7.000     -43.0    -1.300    -9.000      52.0     1.940    -6.000     -34.0     5.000      -0.5    -2.292     -40.4     1.000     100.0     5.000      -0.5     5.000       5.0    0.29  0.82



RMSD table between hits
(RMSDs are shaded according to similarity, up to 10Å )

	1	2	3	4	5
1	0.00	2.95	3.78	2.92	2.89
2	2.95	0.00	3.21	1.65	3.34
3	3.78	3.21	0.00	3.77	4.32
4	2.92	1.65	3.77	0.00	4.85
5	2.89	3.34	4.32	4.85	0.00



Similarity table for hits: percentage of chain fitting below 3Å RMSD
(Cells are shaded according to similarity starting at 30%)

	1	2	3	4	5
1	100.00	100.00	89.29	100.00	100.00
2	100.00	100.00	81.25	100.00	92.98
3	89.29	81.25	100.00	87.10	78.33
4	100.00	100.00	87.10	100.00	82.54
5	100.00	92.98	78.33	82.54	100.00



Similarity table for hits: percentage of chain fitting below 6Å RMSD
(Cells are shaded according to similarity starting at 50%)

	1	2	3	4	5
1	100.00	100.00	100.00	100.00	100.00
2	100.00	100.00	100.00	100.00	100.00
3	100.00	100.00	100.00	100.00	100.00
4	100.00	100.00	100.00	100.00	100.00
5	100.00	100.00	100.00	100.00	100.00





ALIGNMENTS

--> hit 1 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 53.42% helical, 12.33% extended, 34.25% loops/other (query: 51.35%  8.11% 40.54%)

  SCOP classification:  [All alpha proteins]/[DNA/RNA-binding 3-helical bundle]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
a.4.5.6.1_A          a.4.5.6       102.85.83.1           GUESS   -26.687     0       1  50.45%  19.64%   OPTM     -227.669     -149.300        0.758        0.799        0.529        0.714        0.929      8.960     -19.6     0.610    -6.000      40.5    -0.370   -22.000     -44.5    -0.450     0.750      21.0     0.090     1.310     -18.3    -0.640     1.530      36.4    -0.070     1.430     -14.6     6.150    11.160      10.5     6.940     4.950     -28.5   -30.000    10.000     -29.0   -30.000    17.000     -60.0     2.050    21.000      26.0     3.840    26.000     -56.0     0.610     2.000      48.0     0.470    -4.000     -29.0     5.000      -0.3    -0.138     -46.1     0.000      90.0     5.000      -0.3     5.000       5.0    0.18  0.87

alignment source: OPTM
            HHHHHHHHHH-     ------HHHHHHH-----HHHHHHHHHHHHH---EEE----EEEE
Query:   28 YTMLIISVLGN-----GSTRQNFNDIRSSIPGISSTILSRRIKDLIDSGLVERRSGQITTY   83
Sbjct:   12 AEEYIIESIWNNRFPPGTILPAERELSELIG-VTRTTLREVLQRLARDGWLTIQHGKPTKV   71
            HHHHHHHHH------------HHHHHHHH-- -HHHHHHHHHHHHH---EEEE--EEEEE-

56 residues (50.45%) of query sequence aligned



--> hit 2 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 53.95% helical, 13.16% extended, 32.89% loops/other (query: 51.35%  8.11% 40.54%)

  SCOP classification:  [All alpha proteins]/[DNA/RNA-binding 3-helical bundle]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1XMK_A               a.4.5.19      102.85.83.2           GUESS   -26.755     0       1  56.76%  18.75%   OPTM     -227.483     -117.680        0.683        0.835        0.629        0.776        0.951      7.620     -19.3     0.960     6.500      17.0     0.270     8.500     -54.5     0.770     3.070      17.3    -0.210    -1.430     -16.3     0.970     1.140      30.3     0.130    -1.810     -13.3     6.200     4.660       3.7     8.460     7.610     -33.8   -30.000    14.000     -40.0   -30.000    13.000     -59.0     0.960    18.000      36.0     0.520     8.000     -36.0    -0.020     4.000      44.0     1.280     1.000     -32.0     5.000      -1.7    -2.348     -34.9     0.000 -9.3e+061     5.000      -1.7     5.000       5.0    0.26  0.85

alignment source: OPTM
 +++ there is a problem with all-atom model, click here for details
            HHHHHHHHHH-------HHHHHHH-----HHHHHHHHHHHHH---EEE----EEEEEE--HHHH
Query:   28 YTMLIISVLGNGSTRQNFNDIRSSIPGISSTILSRRIKDLIDSGLVERRSGQITTYALTEKGMN   91
Sbjct:  299 IKEKICDYLFNVS-DSSALNLAKNIGLTKARDINAVLIDMERQGDVYRQGTTPPIWHLTDKKRE  361
            HHHHHHHHHH--- EEHHHHHHHH----HHHHHHHHHHHHH---EEEE-----EEEE-HHHH--

63 residues (56.76%) of query sequence aligned



--> hit 3 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 38.67% helical,  8.00% extended, 53.33% loops/other (query: 51.35%  8.11% 40.54%)

  SCOP classification:  [All alpha proteins]/[DNA/RNA-binding 3-helical bundle]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
a.4.5.11.1_B         a.4.5.11      102.85.83.4           GUESS   -26.989     0       1  61.26%  18.84%   OPTM     -270.420     -181.960        0.698        0.691        0.671        0.819        0.898      7.000     -17.0     0.550    -4.000      39.5     0.850    10.000     -54.0    -0.220     1.570      22.8     0.040    -1.040     -15.9     1.490     4.910      35.0     1.910     2.680     -14.7     5.530    10.930       9.3     6.470     6.010     -29.3   -30.000    16.000     -32.0   -30.000    11.000     -51.0     0.890   -11.000      52.0     1.510     2.000     -40.0     0.500     3.000      39.0     1.190    -2.000     -35.0     5.000      -0.5     4.536     -55.4     4.000      88.0     5.000      -0.5     5.000       5.0    0.35  0.74

alignment source: OPTM
            ---HHHHHHHHHH-  ------HHHHHHH-----HHHHHHHHHHHHH---EEE----EEEEEE--HHHHHH
Query:   25 GKKYTMLIISVLGN--GSTRQNFNDIRSSIPGISSTILSRRIKDLIDSGLVERRSGQITTYALTEKGMNVR   93
Sbjct:  245 LEKRDREILEVLILRFGGGPVGLATLATALSEDPGTLEEVHEPYLIRQGLLKRTPR---GRVATELAYRHL  312
            -HHHHHHHH-------------HHHH--------HHHH--HHHHHH---EEE----   EEE-HHHHHHH-

68 residues (61.26%) of query sequence aligned



--> hit 4 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 50.00% helical, 12.50% extended, 37.50% loops/other (query: 51.35%  8.11% 40.54%)

  SCOP classification: 


 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
2FU4_A               not_found     79.79.79.33           GUESS   -27.050     0       1  63.96%  22.54%   OPTM     -295.346     -137.580        0.792        0.774        0.443        0.818        0.925     11.180     -21.8     1.160    18.500       0.5     2.190     6.000     -72.5    -0.360    -1.140      15.3    -0.780    -0.940     -15.2     0.120    -2.760      27.0    -0.440     1.100     -12.6     5.510     8.570       2.1     6.780     7.860     -31.1   -30.000    -3.000     -27.0   -30.000    13.000     -58.0     0.070    -6.000      38.0     3.500    21.000     -58.0    -0.570    -4.000      40.0     1.220    -3.000     -35.0     5.000      -1.8    -0.341     -35.8     0.000 -9.3e+061     5.000      -1.8     5.000       5.0    0.59  0.89

alignment source: OPTM
            -HHHHHHHH---   HHHHHHHHHH-- -----HHHHHHH-    ----HHHHHHHHHHHHH---EEE--  --EEEEEE
Query:   16 PSESVLHLLGKK---YTMLIISVLGNG-STRQNFNDIRSSI----PGISSTILSRRIKDLIDSGLVERRS--GQITTYAL   85
Sbjct:    3 DNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFEL   82
            -HHHHHHH------HHHHHHHHHH---------HHHHHHHHHH------HHHHHHHHHHHHHH--EEEEE-----EEEEE

            -
Query:   86 T   86
Sbjct:   83 T   83
            -

71 residues (63.96%) of query sequence aligned



--> hit 5 [All-atom model (PDB)] [view all-atom model (PDB) with Chime] [PIR alignment file] [PDB file (backbone only)] [view PDB file (backbone only) with Chime] [hit list]


  secondary structure: 57.53% helical, 10.96% extended, 31.51% loops/other (query: 51.35%  8.11% 40.54%)

  SCOP classification:  [All alpha proteins]/[DNA/RNA-binding 3-helical bundle]

 name                SCOP           SCOP_stat         confidence    score homolog  hits  length   seq.   align    ENE             TE13        old        CGenergy      SIFT2        tma1         tma2      |-------OPTM------| |-------SEQ  (global)-------| |-------SEQ   (local)-------| |-------TRD  (global)-------| |-------TRD   (local)-------| |-------TRS  (global)-------| |-------TRS   (local)-------| |-------TSS  (global)-------| |-------TSS   (local)-------| |-------TSC  (global)-------| |-------TSC   (local)-------| |-------PSM  (global)-------| |-------PSM   (local)-------| |-------SRF  (global)-------| |-------SRF   (local)-------| |-------TBLS------| |-------KMER------| |-------CFTR------| |-------TBSS------| |-------SBLS------|  sec. str.
                                                                                          (%)    ident.  src.    all-atom      all-atom      score      all-atom     all-atom     all-atom     all-atom   r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy    zscore  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy  r-energy    energy    pos. comp.
1LDD_A               a.4.5.34      102.85.83.2           GUESS   -27.083     0       1  56.76%  15.87%   OPTM     -259.329     -116.900        0.388        0.699        0.485        0.794        0.920      7.110     -17.9    -1.400   -20.000      49.5    -1.060    -2.000     -48.0    -0.130    -1.280      22.2    -1.060    -2.660     -13.9    -0.470    -0.860      37.8     0.320     0.320     -13.5     1.660    -4.490      18.5     4.220    -1.210     -26.1   -30.000   -10.000     -21.0   -30.000     6.000     -51.0    -1.260   -28.000      59.0     0.930     7.000     -43.0    -1.300    -9.000      52.0     1.940    -6.000     -34.0     5.000      -0.5    -2.292     -40.4     1.000     100.0     5.000      -0.5     5.000       5.0    0.29  0.82

alignment source: OPTM
            HHH---HHHHHHHHHH-------   HHHHHHH--      ---HHHHHHHHHHHHH---EEE----EEEEE
Query:   22 HLLGKKYTMLIISVLGNGSTRQN---FNDIRSSIP------GISSTILSRRIKDLIDSGLVERRSGQITTYA   84
Sbjct:  775 ELTLQRSLPFIEGMLTNLGAMKLHKIHSFLKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIANGSYEIV  846
            HHHHHHHHHHHHHHHHH--EEHHHHHHHHHHH-----------HHHHHHHHHHHHH---EE-----EEEE-V

63 residues (56.76%) of query sequence aligned




DONE: Sat Aug 16 08:52:59 2008 EST

00%-10%	10%-20%	20%-30%	30%-40%	40%-50%	50%-60%	60%-70%	70%-80%	80%-90%	90%-100%
0	0	26	116	4	1	0	0	0	2